KEGG   Macaca mulatta (rhesus monkey): 698213Help
Entry
698213            CDS       T01028                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00590  Arachidonic acid metabolism
mcc01100  Metabolic pathways
mcc04611  Platelet activation
mcc04726  Serotonergic synapse
mcc04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    698213 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    698213 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    698213 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    698213 (PTGS1)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     698213 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 698213
NCBI-ProteinID: XP_001088157
Ensembl: ENSMMUG00000012886
LinkDB All DBs
Position
15
AA seq 632 aa AA seqDB search
MSRECDPGALRGQEVSWPPGGALNARLSRSSLSSAGSLLLQFLLLLLLLPQLPVLLADPG
APTPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSF
THFLLTHGRWFWEFVNATFIRELLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYY
TRILPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQ
FFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEVYPPSVEE
APVLMHYPRGTPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQL
FQTTRLILIGETIRIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWH
PLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQSAGRIGGGRNMDHHVLHVA
VDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLL
LEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEMGFNIVKTATLKKLV
CLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtgagtgcgaccccggtgccctgcgcggccaggaagtttcttggcctcctggc
ggagccttgaatgccaggctcagccgctcgtctctctcctctgcaggaagtctcttgctc
cagttcttgctgctcctgctcctgctgccgcagctcccggtcctgctagcggacccaggg
gcgcccacgccagtgaatccctgttgttactatccatgccagcaccagggcatctgtgtc
cgcttcggccttgaccgctaccagtgtgactgcacccgcacgggctattccggccccaac
tgcaccatccctggcctatggacctggctccggaattcattgcggcccagcccctctttc
acccacttcctgctcacacacgggcgctggttctgggagtttgtcaatgccaccttcatc
cgagagctgctcatgcgcctggtactcacagtgcgctccaaccttatccccagtcccccc
acctacaactcagcacatgactacatcagctgggagtctttctccaacgtgagctattac
actcgtattctgccctctgtgcctaaagactgccccacgcccatgggaaccaaagggaag
aagcagttgccagatgcccagctcctggcccgccgcttcctgctcaggaggaagttcata
cctgacccccaaggcacgaacctcatgtttgccttctttgcacaacacttcacccaccag
ttcttcaaaacttctggcaagatgggtcctggcttcaccaaggccttgggccatggggta
gacctcggtcacatttatggagacaatctggaacgtcagtatcaactgcggctctttaag
gatgggaaactcaaataccaggtgctggacggagaagtgtacccgccctcagtagaagag
gcgcctgtgttgatgcactacccccgaggcaccccgccccagagccagatggccgtgggc
caggaggtgtttgggctgcttcccgggctcatgctgtatgccacgctctggctacgcgag
cacaatcgtgtgtgtgacctgctgaaggctgagcaccccacctggggtgatgagcagctt
ttccagacgacccgcctcatccttataggggagaccatcaggattgtcatcgaggagtac
gtgcagcagctgagtggctacttcctgcagctaaagtttgacccagagctgctgtttggt
gtccagttccagtaccgcaaccgcattgccatggagttcaaccatctctaccactggcac
cccctcatgcctgactccttcaaggtgggctcccaggagtacagctacgagcagttcttg
ttcaacacctccatgttggtggactatggggtcgaggccctggtggatgccttctctcgc
cagagcgctggccggatcggtgggggcaggaacatggaccaccacgtcctgcacgtggct
gtggatgtcatcagggagtctcgggagatgcggctgcaacccttcaatgagtaccgcaag
aggtttggcatgaagccctacacctccttccaggagctcgtaggagagaaggagatggca
gcggagttggaggagctgtatggagacattgacgcgttggagttctaccctgggctgctt
cttgaaaagtgccatccaaactctatctttggggagagtatgatagagattggggctccc
ttttccctcaagggtctcctagggaatcccatctgttctccggagtactggaagccgagc
acttttggtggcgagatgggctttaacatcgtcaagacggccacactgaagaagctggtc
tgcctcaacaccaagacctgtccctatgtttccttccgtgtgccggatgccagtcaggat
gatgggcctgctgtggagcgaccatccacagagctctga

DBGET integrated database retrieval system