KEGG   Macaca mulatta (rhesus monkey): 698223
Entry
698223            CDS       T01028                                 

Gene name
ROCK1
Definition
(RefSeq) rho-associated protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04350  TGF-beta signaling pathway
mcc04360  Axon guidance
mcc04510  Focal adhesion
mcc04530  Tight junction
mcc04611  Platelet activation
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc04921  Oxytocin signaling pathway
mcc05135  Yersinia infection
mcc05163  Human cytomegalovirus infection
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    698223 (ROCK1)
   04071 Sphingolipid signaling pathway
    698223 (ROCK1)
   04024 cAMP signaling pathway
    698223 (ROCK1)
   04022 cGMP-PKG signaling pathway
    698223 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    698223 (ROCK1)
   04530 Tight junction
    698223 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    698223 (ROCK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    698223 (ROCK1)
   04670 Leukocyte transendothelial migration
    698223 (ROCK1)
   04062 Chemokine signaling pathway
    698223 (ROCK1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    698223 (ROCK1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    698223 (ROCK1)
  09158 Development and regeneration
   04360 Axon guidance
    698223 (ROCK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    698223 (ROCK1)
   05206 MicroRNAs in cancer
    698223 (ROCK1)
   05205 Proteoglycans in cancer
    698223 (ROCK1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    698223 (ROCK1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    698223 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    698223 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcc03036]
    698223 (ROCK1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     698223 (ROCK1)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   698223 (ROCK1)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    698223 (ROCK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 HR1 APH Pkinase_C
Other DBs
NCBI-GeneID: 698223
NCBI-ProteinID: NP_001248063
Ensembl: ENSMMUG00000004656
UniProt: H9EPT5
LinkDB
Position
18
AA seq 1354 aa
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNRTSSNA
DKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
VSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
SQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRLLENSKSQTD
KDYYQLQAILEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLEKVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTGNKERMEDEVKNLTLLLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEETNSMLTKDMEILRRENE
ELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECAHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCDACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLICPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTS
NT seq 4065 nt   +upstreamnt  +downstreamnt
atgtcgactggggacagttttgagactcgatttgaaaaaatcgacaacctgctgcgggat
cccaaatcggaagtgaattcggattgtttgctggatggattggatgctttggtatatgat
ttggattttcctgccttaagaaaaaacaaaaatattgacaactttttaagcagatataaa
gacacaataaataaaatcagagatttacgaatgaaagccgaagattatgaagtagtgaag
gtgattggtagaggtgcatttggagaagttcaattggtaaggcataaatccaccaggaag
gtatatgctatgaagcttctcagcaaatttgaaatgattaagagatctgattctgctttt
ttctgggaagaaagggacatcatggcttttgctaatagtccgtgggttgttcagcttttt
tatgcattccaagatgatcgttatctctacatggtgatggaatacatgcctggtggagat
cttgtaaacttaatgagcaactatgatgtgcctgaaaaatgggcacgattctatactgca
gaagtagttcttgcattggatgcaatccattccatgggttttattcacagagatgtgaag
cctgataacatgctgctggataaatctggacatttgaagttagcagattttggtacttgt
atgaagatgaataaggaaggcatggtacgatgtgatacagcagttggaacacctgattat
atttcccctgaagtattaaaatcccaaggtggtgatggttattatggaagagaatgtgac
tggtggtcggttggggtatttttatacgaaatgcttgtaggtgatacacctttttatgca
gattctttggttggaacttacagtaaaattatgaaccataaaaattcacttacctttcct
gatgataatgacatatcaaaagaagcaaaaaaccttatttgtgccttccttactgacagg
gaagtgagattaggacgaaatggtgtagaagaaatcaaacgacatctcttcttcaaaaat
gaccagtgggcttgggaaacactccgagatactgtagcaccagttgtacctgatttaagt
agtgacattgatactagtaattttgatgacttggaagaagataaaggagaggaagaaaca
ttccctattcctaaagcttttgttggcaatcaactaccttttgtaggatttacatattat
agcaatcgtagatacttatcttcagcaaatcctaatgataacaggactagctccaatgca
gataaaagcttgcaggaaagtttgcagaaaacaatctataagctggaagaacagctgcat
aatgaaatgcagttaaaagatgaaatggagcagaagtgcagaacctcaaacataaaacta
gacaagataatgaaagaattggatgaagagggaaatcaaagaagaaatctagaatctaca
gtgtctcagattgagaaggagaaaatgttgctacagcatagaattaatgagtaccaaaga
aaagctgaacaggaaaatgagaagagaagaaatgtagaaaatgaagtttctacattaaag
gatcagttggaagacttaaagaaagtaagtcagaattcacaacttgctaatgagaagctg
tcccagttacaaaagcagctagaagaagccaatgacttacttaggacagaatcagacaca
gctgtaagactgaggaagagtcacacagaaatgagcaagtcaattagtcagttagagtcc
ctgaacagagagttgcaagagagaaatcgacttttagagaattctaagtcacaaacagac
aaagattattaccagctgcaagctatattggaagctgaacgaagggacagaggtcatgat
tctgagatgatcggagaccttcaagctcgaattacatctttacaagaggaggtgaagcat
ctcaaacataatcttgaaaaagtggaaggagaaagaaaagaggctcaagacatgcttaat
cactcagaaaaggaaaagaataatttagaaatagatttaaactacaaacttaaatcatta
caacaacggttagaacaagaggtaaatgaacacaaagtaaccaaagctcgtttaactgac
aaacatcaatctattgaagaggcaaagtctgtggcaatgtgtgagatggaaaaaaagctg
aaagaagaaagagaagctcgagagaaggctgaaaatcgggttgttcagattgagaaacag
tgttccatgctagacgttgatctgaagcaatctcagcagaaactagaacatttgactgga
aataaagaaaggatggaggatgaagttaagaatctaaccctgctactggagcaggaatca
aataagcggctgttgttacaaaatgaattgaagactcaagcatttgaggcagacaattta
aaaggtttagaaaagcagatgaaacaggaaataaatactttattggaagcaaagagatta
ttagaatttgagttagctcagcttacgaaacagtatagagggaatgaaggacagatgcgg
gagctgcaagatcagcttgaagctgaacagtatttctcgacactttataaaacccaggta
aaggaacttaaagaagaaattgaagaaaaaaacagagaaaatttaaagaaaatacaggaa
ctacaaaatgaaaaagaaactcttgctactcagttggatctagcagaaacaaaagctgag
tctgagcagttggctcgaggccttctggaagaacagtattttgaattgactcaagaaagc
aagaaagctgcttcaagaaatagacaagagattacagataaagatcacactgttagtcgg
cttgaagaaacaaacagcatgctaaccaaagatatggaaatattaagaagagagaacgaa
gagctaacagagaaaatgaagaaggcagaggaagaatataaattggagaaggaggaggag
atcagtaatcttaaggctgcctttgaaaagaatatcaacactgagcgaacccttaaaaca
caggctgttaacaagttggcagaaataatgaatcgaaaagattttaaaattgatagaaag
aaagctaatacacaagatttgagaaagaaagaaaaggaaaatcgaaagctacaactggaa
ctcaaccaagaaagagagaaattcaaccagatggtagtgaaacatcagaaggagctgaat
gacatgcaagcgcaactggtagaagaatgtgcacataggaatgagcttcagatgcagttg
gccagcaaagagagtgatattgagcaattgcgtgctaaacttttggacctctcggattct
acaagtgttgctagttttcctagtgctgatgaaactgatggaaacctcccagagtcaaga
attgaaggttggctttcagtaccaaatagaggaaatataaaacgatatggctggaagaaa
cagtatgttgtggtaagcagcaaaaaaattttgttctataatgatgaacaagataaggag
caatccaatccctctatggtattggacatagataaactgtttcacgttagacctgtaacc
caaggagatgtgtatagagctgaaactgaagaaattcctaaaatattccagatactatat
gcaaatgaaggtgaatgtagaaaagatgtagagatggaaccagtacaacaagctgaaaaa
actaatttccaaaatcacaaaggccatgagtttattcctacactctaccactttcctgcc
aattgtgatgcctgtgccaaacctctctggcatgtttttaagccaccccctgccctagag
tgtcgaagatgccatgttaagtgccacagagatcacttagataagaaagaggacttaatt
tgtccatgtaaagtaagttatgacgtaacatcagcaagagatatgctgctgttagcatgt
tctcaggatgaacaaaaaaaatgggtaactcatttagtaaagaaaatccctaagaatcca
ccatctggttttgttcgtgcctcccctcgaacactttctacaagatccactgcaaatcag
tctttccggaaagtggtcaaaaatacatctggaaaaactagttaa

KEGG   Macaca mulatta (rhesus monkey): 708444
Entry
708444            CDS       T01028                                 

Gene name
ROCK2
Definition
(RefSeq) rho-associated protein kinase 2
  KO
K17388  Rho-associated protein kinase 2 [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04310  Wnt signaling pathway
mcc04360  Axon guidance
mcc04510  Focal adhesion
mcc04530  Tight junction
mcc04611  Platelet activation
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc04921  Oxytocin signaling pathway
mcc05132  Salmonella infection
mcc05135  Yersinia infection
mcc05163  Human cytomegalovirus infection
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    708444 (ROCK2)
   04071 Sphingolipid signaling pathway
    708444 (ROCK2)
   04024 cAMP signaling pathway
    708444 (ROCK2)
   04022 cGMP-PKG signaling pathway
    708444 (ROCK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    708444 (ROCK2)
   04530 Tight junction
    708444 (ROCK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    708444 (ROCK2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    708444 (ROCK2)
   04670 Leukocyte transendothelial migration
    708444 (ROCK2)
   04062 Chemokine signaling pathway
    708444 (ROCK2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    708444 (ROCK2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    708444 (ROCK2)
  09158 Development and regeneration
   04360 Axon guidance
    708444 (ROCK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    708444 (ROCK2)
   05205 Proteoglycans in cancer
    708444 (ROCK2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    708444 (ROCK2)
   05135 Yersinia infection
    708444 (ROCK2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    708444 (ROCK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    708444 (ROCK2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcc03036]
    708444 (ROCK2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     708444 (ROCK2)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   708444 (ROCK2)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    708444 (ROCK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 APH
Other DBs
NCBI-GeneID: 708444
NCBI-ProteinID: NP_001247842
Ensembl: ENSMMUG00000016678
UniProt: H9G236
LinkDB
Position
13
AA seq 1388 aa
MSRPPPTGKMPGAPETVPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFP
ALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAM
KLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNL
MSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMD
ETGMVHCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLV
GTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWH
WDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENL
LLSDSPSCRENDSIQSRKNEESQEIQKKLYTLEEHLSSEIQAKEELEQKCKSVNTRLEKT
AKELEEEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQL
EDLKKRNQNSQISTEKVNQLQRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNR
DLQDKNCLLETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRISGLEEDLKNGKI
LIAKVELEKRQLQERFTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNK
IYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSILDCDLKQSQQKINELLK
QKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMN
LEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLGKELQQK
KQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQE
LTEKDATIASLEETNRTLTSDVANLANEKEELNNKLKDVQEQLSRLKDEEISAAAIKAQF
EKQLLTERTLKTQAVNKLAEIMNRKEPVKRGNDTDVRRKEKENRKLHMELKSEREKLTQQ
MIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGLDSSSIGSGPG
DAEADDGFPESRLEGWLSLPARNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVL
DIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKG
HEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD
ISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSR
QLAPNKPS
NT seq 4167 nt   +upstreamnt  +downstreamnt
atgagccggcccccgccgacggggaaaatgcccggcgcccccgaaaccgtgccgggggac
ggggccggcgcgagccgccagaggaagctggaggcgctgatccgagaccctcgctccccc
atcaacgtggagagcttgctggatggcttaaattccttggtccttgatttagattttcct
gctttgagaaaaaacaagaacatagataatttcttaaatagatatgagaaaattgtgaaa
aaaatcagaggtctacagatgaaggcagaagactatgatgttgtaaaagttattggaaga
ggtgcttttggtgaagtgcagttggttcgtcataaggcatcacagaaggtttatgctatg
aagcttcttagtaagtttgaaatgataaaaagatcagattctgcctttttttgggaagaa
agagatattatggcctttgccaatagcccctgggtggttcagcttttttatgcctttcaa
gatgataggtatctgtacatggtaatggagtacatgcctggtggagaccttgtaaacctt
atgagtaattatgatgtgcctgaaaaatgggccaaattttacactgctgaagttgttctt
gctctggatgcaatacactctatgggtttaatacacagagatgtgaagcctgacaacatg
ctcttggataaacatggacatctaaaattagcagattttggcacgtgtatgaagatggat
gaaacaggcatggtacattgtgatacagcagttggaacacctgattatatatcacctgag
gttctgaaatcacaagggggtgatggttactatgggcgagaatgtgattggtggtctgta
ggtgttttcctttttgagatgctagtgggggatactccattttatgcggattcacttgta
ggaacatatagcaaaattatggatcataagaattcactgtgtttccctgaagatgcagaa
atttccaaacatgcaaagaatctcatctgtgctttcttaacagatagggaggtacgactt
gggagaaatggggtagaagaaatcagacaacatcctttctttaagaatgatcagtggcat
tgggataacataagagaaacggcagctcctgtagtacctgaactcagcagtgacatagac
agcagcaatttcgatgacattgaagatgacaaaggagatgtagaaaccttcccaattcct
aaagcttttgttggaaatcagctgcctttcataggatttacctactatagagaaaattta
ttattaagtgactctccatcttgtagagaaaatgattcaatacaatcaaggaaaaatgaa
gaaagtcaagagattcagaaaaaactgtatacattagaagaacatcttagcagtgagata
caagccaaagaggaactggaacagaagtgcaaatctgttaatactcgcctagaaaaaaca
gcaaaggagctagaagaggagattaccttaaggaaaagtgtggaatcagcattaagacag
ttagaaagagaaaaggcgcttcttcagcacaaaaatgcagaatatcagaggaaagctgat
catgaagcagacaagaaacgaaatttggaaaatgatgttaacagcttaaaagatcaactt
gaagatttgaaaaaaagaaatcaaaactctcaaatatccactgagaaagtgaatcaactc
cagagacaactggatgaaaccaatgctttactgcgaacagaatctgatactgcagcccgg
ttaaggaaaacccaggcagaaagttcaaaacagattcagcagctagaatctaacaataga
gatctacaagataaaaactgcctgctggagactgccaagttaaaacttgaaaaggaattt
atcaatcttcagtcagcactggaatctgaaaggagggatcgaacccatggatcagagata
attaatgatttacaaggtagaatatctggcctagaagaagatttaaagaacggcaaaatc
ttaatagcgaaagtagaactggagaagagacaactgcaggagagatttactgatttggaa
aaggaaaaaagcaacatggaaatagatatgacataccaactaaaagttatacagcagagc
ctagaacaagaagaagctgaacataaggccacaaaggcacgactagcagataaaaataag
atctatgagtccatcgaagaagccaaatcagaagccatgaaagaaatggagaagaagctc
ttggaggaaagaactttaaaacagaaagtggagaacctattgctagaagctgagaaaaga
tgttctatattagactgtgacctcaaacagtcacagcagaaaataaatgagctccttaaa
cagaaagatgtgctgaatgaggatgttaggaacctgacgttaaaaatagagcaagaaact
cagaagcgctgccttacacaaaatgacctgaagatgcaaacacaacaggttaacacactg
aaaatgtcagaaaagcagttaaagcaagaaaataaccatctcatggaaatgaaaatgaac
ttggaaaaacaaaatgctgaacttcgaaaagaacgtcaggatgcagatgggcaaatgaag
gagctccaggatcagctcgaagcagaacagtatttctcaaccctttataaaacacaagtt
agggagcttaaagaagaatgtgaagaaaagaccaaacttggtaaagaattacagcaaaag
aaacaggaattacaggatgaacgggactccttggctgcccaactggagatcaccttgact
aaagcagattctgagcaactggctcgttcaattgctgaagaacaatattctgatttggaa
aaagagaagatcatgaaagagctggagatcaaagagatgatggctagacacaaacaggaa
cttaccgaaaaagatgccacaattgcttctcttgaagaaactaataggaccctaactagt
gatgttgccaatcttgcaaatgagaaagaagaattaaataacaagctgaaagatgttcaa
gagcaactgtcaagattgaaagatgaagaaataagcgcagcagctattaaagcacagttt
gagaaacagctgttaacagaaagaacactcaaaactcaagctgtgaataagttggctgag
atcatgaatcgcaaagaacctgtcaagcgtggtaatgacacagatgtgcggagaaaagag
aaggagaatagaaagctacatatggagcttaaatctgaacgtgagaaattgacccagcag
atgatcaagtatcagaaagaactgaatgaaatgcaggcacaaatagctgaagagagccag
attcgaattgaactgcagatgacattggacagtaaagacagtgacattgagcagctgcgg
tcacaactccaagccttgcatattggtctggatagttccagtataggcagtggaccaggg
gatgctgaggcagatgatgggtttccagaatcaagattagaaggatggctttcattgcct
gcacgaaacaacactaagaaatttggatgggttaaaaagtatgtgattgtaagcagtaag
aagattcttttctatgacagtgaacaagataaagaacaatctaatccttacatggtttta
gatatagacaagttatttcatgtccgaccagttacacagacagatgtatatagagcagat
gctaaagaaattccaaggatattccagattctgtatgccaatgaaggagaaagtaagaag
gaacaagaatttccagtggagccagttggagaaaaatctaattatatttgccacaaggga
catgagtttattcctactctttatcatttcccaaccaactgtgaggcttgtatgaagccc
ctgtggcacatgtttaagcctcctcctgctttagagtgccgccgttgccatattaagtgt
cataaagatcacatggacaaaaaggaggagattatagcaccttgcaaagtgtattatgat
atttcaacggcaaagaatctattattactagcaaattctacagaagagcagcagaagtgg
gttagtcgattggtgaaaaagataccaaaaaagcccccagctccagacccttttgcacga
tcatctcctagaacttcaatgaagatacagcaaaaccagtctattagacggccaagtcga
cagcttgccccaaacaaacctagctaa

DBGET integrated database retrieval system