KEGG   Macaca mulatta (rhesus monkey): 698444
Entry
698444            CDS       T01028                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I precursor
  KO
K05459  insulin-like growth factor 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04114  Oocyte meiosis
mcc04115  p53 signaling pathway
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04510  Focal adhesion
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04730  Long-term depression
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04913  Ovarian steroidogenesis
mcc04914  Progesterone-mediated oocyte maturation
mcc04935  Growth hormone synthesis, secretion and action
mcc04960  Aldosterone-regulated sodium reabsorption
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05205  Proteoglycans in cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05224  Breast cancer
mcc05410  Hypertrophic cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    698444 (IGF1)
   04014 Ras signaling pathway
    698444 (IGF1)
   04015 Rap1 signaling pathway
    698444 (IGF1)
   04066 HIF-1 signaling pathway
    698444 (IGF1)
   04068 FoxO signaling pathway
    698444 (IGF1)
   04151 PI3K-Akt signaling pathway
    698444 (IGF1)
   04152 AMPK signaling pathway
    698444 (IGF1)
   04150 mTOR signaling pathway
    698444 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    698444 (IGF1)
   04115 p53 signaling pathway
    698444 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    698444 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    698444 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    698444 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    698444 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    698444 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    698444 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    698444 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    698444 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    698444 (IGF1)
   04213 Longevity regulating pathway - multiple species
    698444 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    698444 (IGF1)
   05202 Transcriptional misregulation in cancer
    698444 (IGF1)
   05205 Proteoglycans in cancer
    698444 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    698444 (IGF1)
   05218 Melanoma
    698444 (IGF1)
   05215 Prostate cancer
    698444 (IGF1)
   05224 Breast cancer
    698444 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    698444 (IGF1)
   05414 Dilated cardiomyopathy
    698444 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    698444 (IGF1)
   01522 Endocrine resistance
    698444 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    698444 (IGF1)
Cytokines and growth factors [BR:mcc04052]
 Growth factors
  Growth factors (RTK binding)
   698444 (IGF1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 698444
NCBI-ProteinID: NP_001247655
Ensembl: ENSMMUG00000002235
UniProt: F6W003
LinkDB
Position
11
AA seq 153 aa
MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKTQKEVHLKNASRGSAGNKNYRM
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtgaagatgcacaccatgtcctcctcgcatctcttctacctggcactgtgcctgctc
accttcaccagctccgccacggctggaccggagacgctctgcggggctgagctggtggat
gctcttcagttcgtgtgtggagacaggggcttttatttcaacaagcccacagggtatggc
tccagcagtcggagggcacctcagacaggcatcgtggatgagtgctgcttccggagctgt
gatctgagaaggctggagatgtattgcgcacccctcaagcctgccaagtcagcccgctct
gtccgtgcccagcgccataccgacatgcccaagacccagaaggaagtacatttgaagaac
gcaagtagagggagtgcaggaaacaagaactacagaatgtag

DBGET integrated database retrieval system