KEGG   Macaca mulatta (rhesus monkey): 698553Help
Entry
698553            CDS       T01028                                 

Gene name
LYN
Definition
(RefSeq) tyrosine-protein kinase Lyn isoform X1
  KO
K05854  tyrosine-protein kinase Lyn [EC:2.7.10.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04062  Chemokine signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04611  Platelet activation
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04730  Long-term depression
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    698553 (LYN)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    698553 (LYN)
   04662 B cell receptor signaling pathway
    698553 (LYN)
   04664 Fc epsilon RI signaling pathway
    698553 (LYN)
   04666 Fc gamma R-mediated phagocytosis
    698553 (LYN)
   04062 Chemokine signaling pathway
    698553 (LYN)
  09156 Nervous system
   04730 Long-term depression
    698553 (LYN)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    698553 (LYN)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    698553 (LYN)
   05169 Epstein-Barr virus infection
    698553 (LYN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    698553 (LYN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    698553 (LYN)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     698553 (LYN)
Protein kinases [BR:mcc01001]
 Non-receptor tyrosine kinases
  SRC family
   698553 (LYN)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    698553 (LYN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase SH3_3
Motif
Other DBs
NCBI-GeneID: 698553
NCBI-ProteinID: XP_001087049
Ensembl: ENSMMUG00000014149
UniProt: F7BV42
LinkDB All DBs
Position
8
AA seq 512 aa AA seqDB search
MGCIKSKGKDSLNDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQAKD
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAK
LNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQPDGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgggatgtataaaatcaaaagggaaagacagcttgaatgacgatggagtagatttgaag
actcaaccagtacgtaatactgaaagaactatttatgtgagagatccaacgtccaataaa
cagcaaaggccagttccagaatctcagcttttacctggacagaggtttcaagctaaagat
ccagaggaacaaggagacattgtggtagccttgtacccgtatgatggcatccacccggac
gacttgtctttcaagaaaggagagaagatgaaagtcctggaggagcatggagaatggtgg
aaagcaaagtcccttttaacaaaaaaagaaggcttcatccccagcaactatgtggccaaa
ctcaacaccttagaaacagaagagtggtttttcaaggatataaccaggaaggacgcagaa
aggcagcttttggcaccaggaaatagtgctggagctttccttattagagaaagtgaaacg
ttaaaaggaagcttctctctgtctgtcagagactttgaccctgtgcatggggatgttatt
aagcactacaaaattagaagtctggataatgggggctattacatctctccacgaatcact
tttccctgtatcagcgacatgattaaacattaccaaaagcagccagatggcttgtgcaga
agattggagaaggcttgtattagtcccaagccacagaagccatgggataaagatgcctgg
gagatcccccgggagtccatcaagttggtgaaaaggctcggcgctgggcagtttggggaa
gtctggatgggttactataacaacagtaccaaggtggctgtgaaaaccctgaagccgggc
actatgtctgtgcaagccttcctggaagaagccaacctcatgaagactctgcagcatgat
aagctcgtgaggctgtacgctgtggtcaccagggaggagcccatttacattatcaccgag
tacatggccaagggcagtttgctggatttcctgaagagcgatgaaggtggcaaagtgctg
cttccaaagctcattgacttttctgctcagattgcagagggaatggcgtacatcgagcgg
aagaactacattcaccgggacctgcgagcagctaatgtcctggtctccgagtcactcatg
tgcaaaattgcagattttggccttgctagagtaattgaagataatgagtacacagcaagg
gaaggtgctaagttccctattaagtggacggctccagaagcaatcaactttggatgtttc
actattaagtctgatgtgtggtcctttggaatcctcctatacgaaatcgtcacctatggg
aaaattccctacccagggagaactaatgccgacgtgatgaccgccctgtcccagggctac
aggatgccccgtgtggagaactgcccagatgagctctatgacattatgaaaatgtgctgg
aaagaaaaggcagaagagagaccaacatttgattacttacagagcgtcctggatgatttc
tacacagccacggaagggcagtaccagcagcagccttag

DBGET integrated database retrieval system