KEGG   Macaca mulatta (rhesus monkey): 698604
Entry
698604            CDS       T01028                                 

Gene name
EEF2K
Definition
(RefSeq) eukaryotic elongation factor 2 kinase
  KO
K08292  elongation factor 2 kinase [EC:2.7.11.20]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04152  AMPK signaling pathway
mcc04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    698604 (EEF2K)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    698604 (EEF2K)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    698604 (EEF2K)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     698604 (EEF2K)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: Other
  Alpha family [OT]
   698604 (EEF2K)
SSDB
Motif
Pfam: Alpha_kinase Sel1
Other DBs
NCBI-GeneID: 698604
NCBI-ProteinID: XP_001092565
Ensembl: ENSMMUG00000017725
LinkDB
Position
20
AA seq 725 aa
MADEDLIFRLEGVDGGQSPQTGHDGDSDGDSDDEEGYFICPITDDPRSNQNVNSKVNKYY
SNLTKSERYGSSGSPANSFHFKEAWKHAIEKAKHMPDPWAEFHLEDIATERATRHRYNAV
TGEWLDDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELRDRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNL
GVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP
RVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN
MASRDHDHLDNHRDSENSGDSGYPSEKRGELDDPEPREHGHSNGNRKYESDEDSLGSCGR
VCVEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFC
EKGEEWDRESAVFHLEHAADLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFYY
LLKAAEAGDRQSMILMARAFDTGQNLSPDRCRDWLEALHWYKTALEMTDCDEGGEYDGMQ
DEPRYTMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAW
AQMEE
NT seq 2178 nt   +upstreamnt  +downstreamnt
atggcagacgaagatctcatcttccgcctggaaggcgttgatggcggtcagtccccccaa
actggccatgatggtgattctgatggggacagcgacgatgaggaaggttacttcatctgc
cccatcactgatgacccaaggtcgaaccagaatgtcaattccaaggttaataagtactac
agcaacctaacaaaaagtgagcggtatggatccagtgggtccccggcaaactctttccac
ttcaaggaagcctggaagcacgcaatcgagaaggccaagcacatgcccgacccctgggct
gagttccacctagaagacattgccaccgaacgtgctactcgacacaggtacaacgctgtc
accggggaatggctggatgatgaagttctgatcaagatggcatctcagcccttcggccga
ggagcaatgagggagtgcttccggacgaagaagctctccaacttcctgcatgcccagcag
tggaagggagcctccaactacgtggcgaagcgctacatagagccggtagaccgggatgtg
tactttgaggacgtgcgtctacagatggaggccaagctctggggggaggagtataaccgg
cacaagccccccaagcaggtggacatcatgcagatgtgcatcatcgagctgagggacaga
ccgggcaagcccctcttccacctggagcactacatcgagggcaagtacatcaagtacaat
tccaactctggctttgtccgtgatgacaacatccgcctgacgccgcaggccttcagtcac
ttcacgtttgagcgttccggccatcagctgatagtggtggacatccagggagttggggat
ctctacactgacccacagatccacacagagacgggcactgactttggagacggcaaccta
ggtgtccgtgggatggcgctcttcttctactctcatgcctgcaaccggatttgcgagagc
atgggccttgctccctttgacctctcgccccgggagagggacgcggtgaatcagaacacc
aagctgctgcaatcagccaagaccatcttgagaggaacagaggaaaaatgtgggagcccc
cgagtaaggaccctctctgggagccggccacccctgctccgtcccctttcagagaactct
ggagatgagaacatgagcgatgtgaccttcgactctctcccttcttccccatcttcggcc
acaccacacagccagaagctagaccacctccattggccagtgttcagtgacctcgataac
atggcatccagagaccatgatcatctagacaaccaccgggactctgagaatagtggggac
agtggataccccagtgagaagcggggtgagctggatgaccctgagccccgagaacatggc
cactcaaacggtaaccggaagtacgagtctgacgaagacagcctgggcagctgcggacgg
gtctgtgtagagaagtggaatctcctcaactcctcccgcctccacctgccgagggcttcg
gccgtggccctggaagtgcaaaggcttaatgctctggacctcgaaaagaaaatcgggaag
tccattttggggaaggtccatctggccatggtgcgctaccacgagggtgggcgcttctgc
gagaagggcgaggagtgggaccgggagtcggctgtcttccacctggagcacgcggccgac
ctgggcgagctggaggccatcgtgggcctgggactcatgtactcgcagctgccccatcac
atcctagctgacgtctctctgaaggagacagaagagaacaaaaccaaaggattttattat
ttactgaaggccgcagaagctggtgacaggcagtccatgatcctgatggcgcgagctttt
gacactggccagaacctcagcccagacaggtgccgagactggctggaggccctgcactgg
tacaaaactgccctggagatgacggactgtgatgagggtggtgagtacgacggaatgcag
gacgagccccggtacacgatgctggccagggaggccgaaatgctgttcacaggaggctat
gggctggagaaggacccgcagagatcaggggacttgtatacccaggcagcagaggcagcg
atggaagccatgaagggccggctggccaaccagtactaccaaaaggctgaagaggcctgg
gcccagatggaggagtaa

DBGET integrated database retrieval system