KEGG   Macaca mulatta (rhesus monkey): 698619
Entry
698619            CDS       T01028                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor isoform X2
  KO
K04357  epidermal growth factor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04540  Gap junction
mcc04630  JAK-STAT signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05160  Hepatitis C
mcc05165  Human papillomavirus infection
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05226  Gastric cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    698619 (EGF)
   04012 ErbB signaling pathway
    698619 (EGF)
   04014 Ras signaling pathway
    698619 (EGF)
   04015 Rap1 signaling pathway
    698619 (EGF)
   04630 JAK-STAT signaling pathway
    698619 (EGF)
   04066 HIF-1 signaling pathway
    698619 (EGF)
   04068 FoxO signaling pathway
    698619 (EGF)
   04020 Calcium signaling pathway
    698619 (EGF)
   04072 Phospholipase D signaling pathway
    698619 (EGF)
   04151 PI3K-Akt signaling pathway
    698619 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    698619 (EGF)
   04540 Gap junction
    698619 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    698619 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    698619 (EGF)
   05231 Choline metabolism in cancer
    698619 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    698619 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    698619 (EGF)
   05212 Pancreatic cancer
    698619 (EGF)
   05226 Gastric cancer
    698619 (EGF)
   05214 Glioma
    698619 (EGF)
   05218 Melanoma
    698619 (EGF)
   05219 Bladder cancer
    698619 (EGF)
   05215 Prostate cancer
    698619 (EGF)
   05213 Endometrial cancer
    698619 (EGF)
   05224 Breast cancer
    698619 (EGF)
   05223 Non-small cell lung cancer
    698619 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    698619 (EGF)
   05165 Human papillomavirus infection
    698619 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    698619 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    698619 (EGF)
Cytokines and growth factors [BR:mcc04052]
 Growth factors
  Growth factors (RTK binding)
   698619 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF EGF_CA EGF_3 DUF5050 SGL
Other DBs
NCBI-GeneID: 698619
NCBI-ProteinID: XP_001088957
Ensembl: ENSMMUG00000010043
LinkDB
Position
5
AA seq 1208 aa
MLLPLIILLPVVLKFSCVSLSAPQHWSCPEGTPAGHGNSTRVGPAPFLIFSHGNSIFRID
TEGTNYEPLVVDAGVSVIMDFHYKEKTIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSG
MAINWINEEVIWSNQQEGIITVTDMKGNNSHVLLSALKYPANIAVDPVERFIFWSSEVAG
SLYRADLDGVEVKSLLETSEKITAVSLDVLDKRLFWIQYSREGSNSLICSCDYDGGSVHV
SKHPTQHNLFAMSLFGDHVFYSTWKTRTIWIANKHTGKDMVRINLHPSFVPPGELKVVHP
LAQPKAEDDAREREQKLHKLRKGNCSSTVCGQDAQSHLCTCAEGYALSRDRKYCEDVNEC
AFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPSNVSECSHDCVLTSEGPL
CFCPEGSVLERDGKTCSGCSSPDNGGCSQLCIPLSPVSWECDCFPGYDLQLDKKSCVASG
PQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLIEEGVDVPEGLAVDWIGRRFYWTDRGKSLIGRSDLNGKHPKIIIKENISQP
RGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPNGITIDFLTDKLYWCD
AKQSVIEMANLDGSKRRTLTQNDVGHPFAIAVFEDYVWFSDWAMPSVIRVNKKTGKDRVR
LQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKERLGTAWCLCREGFMKASDGKTC
LALDGHQLLAGGEVDLKNQVTPLDTLSKTRVSEDNITESQHMLVAEITVSDQYDCAPVGC
STYARCVSEGKDVTCQCLKGFAGDGILCSDIDECEMGVPVCPPASSKCINTEGGYVCQCS
EGYRGDGIHCLDIDECQLGVHSCGENANCTNTEGGYTCTCAGRLSEPGLICPDSTPPPHL
REDGHHYSVRNSDSGCPLSHDGYCLHDGVCMYIEPLDKYACNCVVGYIGERCQYRDLKWW
ELRHAGHGQQQKVTVVAVCVVVLVVLLLLSLWGAHYYRTQKLLTKNPKNPSEESSRDARS
HRPADREDGMSSCPQPWFVVTKEHQDLRNGSQPVAGEDGQAADVGSVQPTSWRQKPQLCG
VGPEQGCWIPVSSDKGSCPQVMERSFHMPSYGTRPVDGGVQKPHSLLSVNSLWQQRALDP
PHQMELTQ
NT seq 3627 nt   +upstreamnt  +downstreamnt
atgctgctccctcttatcattctgttgccagtagttttaaaatttagttgtgttagtctc
tcagcaccacagcactggagctgtcctgaaggtactcctgcaggacatgggaattctact
cgtgtgggtcctgcacccttcttaattttctcccacggaaatagtatctttaggattgac
acggaaggaaccaattatgagccattggtggtggatgctggtgtctcagtgatcatggat
tttcattataaagagaaaacaatctattgggtggatttagaaagacaacttttgcaaaga
gtttttctgaatgggtcaaggcaagagagagtatgtaatatagagaaaaatgtttctgga
atggcaataaattggataaatgaagaagttatttggtcaaatcaacaggaaggaatcatt
acagtaacagatatgaaaggaaataattcccacgttcttttaagtgctttaaaatatcct
gcaaatatagcagttgatccagtagaaaggtttatattttggtcttcagaggtggctggc
agcctttacagagcagatcttgatggtgtggaagtgaagtctctgttagagacatcagag
aaaataacggctgtgtcattggatgtgcttgataagcggctgttttggattcagtacagc
agagaaggaagcaattctcttatttgctcctgtgattatgatggaggttctgtccatgtt
agtaaacatccaacacagcacaatttgtttgcaatgtccctttttggtgaccatgtcttc
tattcaacatggaaaacgaggacaatttggatagccaacaaacacactggaaaggatatg
gttagaattaacctccatccatcatttgtaccacctggtgaactgaaagtagtgcatcca
cttgcacagcccaaggcagaagatgatgctcgggagcgtgagcagaaacttcacaaattg
aggaaaggaaactgcagcagcactgtgtgtgggcaagacgcccagtcacacttgtgcacg
tgtgcagagggatacgccttaagtcgagaccggaagtattgtgaagatgttaatgaatgt
gctttttggaatcatggctgtactcttgggtgtaaaaacacccctggatcctattactgc
acatgccctgtaggatttgttctgcttcctgatgggaaacgatgtcatcaacttgtttcc
tgtccaagcaatgtgtctgaatgcagccatgactgtgttctgacgtcagaaggtccctta
tgtttctgtcctgaaggctcagtgcttgagagagatgggaaaacatgtagcggttgttct
tcacccgataatggtggatgtagccagctctgcattcctctcagcccagtatcctgggaa
tgtgattgctttcctgggtatgacctacaactggataaaaaaagctgtgtagcttcagga
ccacaaccatttttgctgtttgccaattctcaagatattcgacacatgcattttgatgga
acagactatggaactctgctcagccagcagatgggaatggtttatgccctagatcatgac
cctgtggaaaataagatatactttgcccatacagccctgaagtggatagagagagctaat
atggatggttcccagcgagaaaggcttattgaggaaggagtagatgtgccagaaggtctt
gctgtggactggattggccgtagattctattggacagacagagggaaatctctgattgga
aggagtgatttaaatggaaaacatcccaaaataatcattaaggagaatatctctcaacca
cgaggaattgctgttcatccaatggccaagagattattctggacggatacagggattaat
ccacgaattgaaagttcttccctccaaggccttggccgactggttatagccagctctgat
ctaatctggcccaatggaataacgattgacttcttaactgacaagttgtattggtgcgat
gccaagcagtctgtgattgaaatggccaatctggatggttcaaaacgccgaacacttacc
cagaacgatgtaggtcacccatttgctatagccgtgtttgaggattatgtgtggttctca
gattgggctatgccatcagtaataagagtaaacaagaagactggcaaagatagagtacgt
ctccaaggcagcatgctgaagccctcctcactggttgtggttcatccattggcaaaacca
ggagcagatccctgcttatatcaaaacggaggctgtgaacatatttgcaaagagaggctt
ggaactgcttggtgtttgtgtcgtgaaggttttatgaaagcctcagatgggaaaacgtgt
ctggctctggatggtcatcagctgttggcaggtggtgaagttgatctaaagaaccaggta
acaccattggacaccttatcgaagactagagtgtcagaagataacattacagaatctcaa
cacatgctagtggctgaaatcacggtgtcagatcaatatgactgtgctcctgtgggatgc
agcacgtatgctcggtgtgtttcagagggaaaggatgtcacgtgtcagtgtttgaaagga
tttgctggggatggaatactatgttctgatatagatgaatgtgagatgggtgtcccagtg
tgcccccctgcctcctccaagtgcatcaacaccgaaggcggctatgtctgccagtgctca
gaaggctaccgaggagatgggattcactgtcttgatattgatgagtgccaactgggggtg
cacagctgtggagagaatgccaactgcacaaatacagagggcggctacacctgcacgtgt
gctgggcgcctgtctgaaccaggactgatttgccctgactctactccaccccctcacctc
agggaagatggccaccactattccgtaagaaatagtgactctggatgtcccctgtcccac
gatggatactgcctccatgatggtgtgtgcatgtatattgaaccattggacaagtatgca
tgcaactgtgttgttggctacatcggggagcgatgtcagtaccgagacctgaagtggtgg
gaactgcgtcatgctggccacgggcagcagcagaaggtcaccgtggtggctgtctgcgtg
gtggtgcttgtcgtgctgctcctcctgagcctgtggggtgcccactactacaggactcag
aagctgctaacgaaaaatccaaagaatccttctgaggagtcaagcagagacgcgaggagt
cataggcctgctgacagagaggatgggatgtcctcttgccctcaaccttggtttgtggtt
acaaaggaacaccaagacctcaggaatgggagtcaaccagtggctggtgaggatggccag
gcagcagatgttgggtcagtgcaaccaacttcatggaggcagaagccccagttatgtgga
gtgggcccagagcaaggctgctggattccagtatccagtgataagggctcctgtccccag
gtaatggagcgaagctttcatatgccctcctatgggacacggcccgtcgatgggggtgtc
cagaagccccattctctcctatcagttaactcattatggcaacaaagggccctggaccca
ccacaccaaatggagctgactcagtga

DBGET integrated database retrieval system