KEGG   Macaca mulatta (rhesus monkey): 698729Help
Entry
698729            CDS       T01028                                 

Gene name
PRSS1
Definition
(RefSeq) protease, serine, 1 (trypsin 1)
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04080  Neuroactive ligand-receptor interaction
mcc04972  Pancreatic secretion
mcc04974  Protein digestion and absorption
mcc05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    698729 (PRSS1)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    698729 (PRSS1)
   04974 Protein digestion and absorption
    698729 (PRSS1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    698729 (PRSS1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     698729 (PRSS1)
Peptidases [BR:mcc01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   698729 (PRSS1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   698729 (PRSS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 ICMT
Motif
Other DBs
NCBI-GeneID: 698729
NCBI-ProteinID: NP_001040586
Ensembl: ENSMMUG00000045279
UniProt: Q5H730
LinkDB All DBs
Position
3
AA seq 247 aa AA seqDB search
MNPLLILTFVGAAVAAPFDDDDKIVGGYTCGKNSLPYQVSLNSGYHFCGGSLINNQWVVS
AGHCYKTRIQVRLGEHNIEVLEGTEQFINAAKIIRHPNYNRNTLNNDILLIKLSSPAVIN
ARVSTISLPTAPPAAGAKCLISGWGNTLSSGADYPDELQCLEAPVLTQAKCEASYPGRIT
SNMFCAGFLEGGKDSCQGDSGGPVVSNGQLQGIVSWGDGCAQKNKPGVYTKVYNYLTWIK
NTIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatccactcctgatccttacctttgtgggagctgctgttgctgccccctttgacgat
gatgacaagatcgttgggggctacacctgtgggaagaattctctcccctaccaggtgtcc
ctgaattctggctaccacttctgcggtggctccctcattaacaaccagtgggtggtgtca
gcaggtcactgctacaagacccgcatccaggtgagactgggagagcacaacatcgaagtc
ctggagggaactgagcagttcatcaatgcagccaagatcatccgccaccccaattataac
aggaatactctgaacaatgacatcctgctgatcaagctctcctcacctgccgtcatcaat
gcccgtgtgtccaccatctctctgcccaccgcccctccagctgctggcgccaagtgtctc
atctctggctggggcaacactctgagctctggtgccgactacccagatgagctgcagtgc
ctggaagctcctgtactgacccaggctaagtgtgaagcctcctaccctggaaggattacc
agcaacatgttctgtgcgggcttccttgagggaggcaaggattcctgccagggtgactct
ggtggccctgttgtctccaacggacagctccaaggaattgtctcctggggcgatggctgt
gcccagaagaacaagcctggagtctacaccaaggtctacaactatttgacctggattaag
aataccatagctgcaaacagctaa

DBGET integrated database retrieval system