KEGG   Macaca mulatta (rhesus monkey): 698736
Entry
698736            CDS       T01028                                 

Gene name
GRM1
Definition
(RefSeq) metabotropic glutamate receptor 1 precursor
  KO
K04603  metabotropic glutamate receptor 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04068  FoxO signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04080  Neuroactive ligand-receptor interaction
mcc04540  Gap junction
mcc04720  Long-term potentiation
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04730  Long-term depression
mcc04742  Taste transduction
mcc04915  Estrogen signaling pathway
mcc05017  Spinocerebellar ataxia
mcc05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    698736 (GRM1)
   04020 Calcium signaling pathway
    698736 (GRM1)
   04072 Phospholipase D signaling pathway
    698736 (GRM1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    698736 (GRM1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    698736 (GRM1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    698736 (GRM1)
  09156 Nervous system
   04724 Glutamatergic synapse
    698736 (GRM1)
   04720 Long-term potentiation
    698736 (GRM1)
   04730 Long-term depression
    698736 (GRM1)
   04723 Retrograde endocannabinoid signaling
    698736 (GRM1)
  09157 Sensory system
   04742 Taste transduction
    698736 (GRM1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    698736 (GRM1)
   05022 Pathways of neurodegeneration - multiple diseases
    698736 (GRM1)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     698736 (GRM1)
G protein-coupled receptors [BR:mcc04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   698736 (GRM1)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G DUF5438 DUF2318 AAA_34
Other DBs
NCBI-GeneID: 698736
NCBI-ProteinID: NP_001252684
Ensembl: ENSMMUG00000016428
UniProt: I2CU04 G7MQ67
LinkDB
Position
4
AA seq 1195 aa
MVGLLLVFFPAIFLEVSLLPRSPGRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAE
KVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSI
EFIRDSLISIRDEKDGFNRCLPDGQSLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDI
PQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESG
MDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLL
SAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLD
TNTRNPWFPEFWQHRFQCRLPGHLLENPNFKRICTGNESLEENYVQDSKMGFVINAIYAM
AHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYD
IMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKSGMVRSVCSEPCLKGQIKVIRKGE
VSCCWICTACKENEYVQDEFTCKACDLGWWPNADLTGCEPIPVRYLEWSNIESIIAIAFS
CLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQ
RLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTL
VVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPLGYNGLLIMSCTYYAFKTRNVPAN
FNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIA
KPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKAGTGNANSNGKSVSWSEPGG
GQMSKGQHMWQRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYNVEEE
EDAQPVRFSPPGSPSMVVHRRVPSTATTPPLPPHLTSEETPLFLADPALPKGLPPLLQQQ
QQQPPPQQKSLMDQLQGVVSNFSTAIPDFHAVLAGPGGPGNGLRSLYQPPPPPQHLQMLP
LQLSTFEEELVSPPADDDDDSERFKLLQEYVYEHEREGNTEEDELEEEEEDLQAASKLTP
EDSPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVSYASVILRDYKQSSSTL
NT seq 3588 nt   +upstreamnt  +downstreamnt
atggtcgggctcctcttggtttttttcccagcgatatttttggaagtgtcccttctcccc
agaagccccggcaggaaagtgttgctggcgggagcgtcgtctcagcgctcggtggccaga
atggacggagatgtcatcattggagccctcttctcagtccatcaccaacctccggccgag
aaagtgcccgagaggaagtgtggggagatcagggagcagtatggtatccagagggtggag
gccatgttccacacgttggataagatcaacgcggacccagtcctcctgcccaacatcacc
ctgggcagtgagatccgggactcctgctggcactcttccgtggctctggaacagagcatt
gagttcattagggactctctgatttccattcgagatgagaaggatgggttcaaccggtgc
ctgcctgacggccagtcccttccccccggcaggactaagaagcccattgcgggagtgatc
ggtcctggctccagctctgtagccattcaagtgcagaacctgctccagctcttcgacatc
ccgcagatcgcttattcagccacaagcatcgacctgagtgacaaaactttgtacaaatac
ttcctgagggttgtcccttctgacactttgcaggcaagggccatgcttgacatagtcaaa
cgttacaattggacctatgtctctgcagtccacaccgaagggaattacggggagagcgga
atggacgctttcaaagagttggctgcccaggaaggcctctgcatcgcccattctgacaaa
atctacagcaatgctggggaaaagagctttgatcgactcttgcgcaaactccgagagagg
cttcccaaggccagagtggtggtctgcttctgcgaaggcatgacagtgcgaggactcctg
agcgccatgcggcgccttggtgtcgtgggcgagttctcactcattggaagtgatggatgg
gcagacagagatgaagtcattgaaggttatgaggtggaagccaacgggggaatcacgata
aagctgcagtctccggaggtcaggtcattcgatgattatttcctgaaactgaggctggac
actaacacaaggaatccctggttccctgagttctggcaacatcggttccagtgccgcctt
ccaggacaccttctggaaaatcccaactttaaacgaatctgcacaggcaatgaaagctta
gaagaaaactatgtccaggacagtaagatggggtttgtcatcaatgccatctatgccatg
gcacatgggctgcagaacatgcaccatgccctctgccctggccacgtgggcctctgcgat
gccatgaagcccatcgacggcagcaagctcctggacttcctcatcaagtcctcattcatc
ggcgtatctggagaggaagtgtggtttgatgagaaaggagatgctcctggaaggtatgat
atcatgaatctgcagtacactgaagctaatcgctatgactatgttcacgttggaacctgg
catgaaggagtgctgaacattgatgattacaaaatccagatgaacaagagtggaatggtg
cggtctgtgtgcagtgagccttgcttaaaaggccagattaaggttatacggaagggagaa
gtgagttgctgttggatttgcacggcctgcaaagagaacgaatatgtgcaagatgagttc
acctgcaaagcttgtgacttgggatggtggcccaatgcagatctaacaggctgtgagccc
attcctgtccgctatctagagtggagcaacatcgaatccatcatagccatcgccttctca
tgcctgggaatccttgttaccttgtttgtcaccctaatctttgtactgtaccgggacaca
ccagtggtcaaatcctccagtcgggagctctgctacatcattctagctggcatcttcctt
ggttatgtgtgcccattcactctcattgccaaacctactaccacttcctgctacctccag
cgcctcttggttggcctctcctctgcgatgtgctactctgctttagtgactaaaaccaat
cgcattgcacgcatcctggctggcagcaagaagaagatctgcacccggaagcccaggttc
atgagtgcctgggctcaggtgatcattgcctcaattctgattagtgtgcaacttaccctg
gtggtaaccctgatcatcatggagccccctatgcccattctatcctacccaagtatcaag
gaagtctaccttatctgcaataccagcaacctgggtgtggtggcacctttgggctacaat
ggactcctcatcatgagctgtacctactatgccttcaagacccgcaacgtgcccgccaac
ttcaatgaggccaaatatatcgccttcaccatgtacaccacctgtatcatctggctagct
tttgtgcccatttactttgggagcaactacaagatcatcacaacttgctttgcagtgagt
ctcagtgtaacagtggctctggggtgcatgttcactcccaagatgtacatcattattgcc
aagcctgagaggaatgtccgcagtgccttcaccacctctgatgttgtccgcatgcatgtt
ggcgatggcaagctgccctgccgctccaacactttcctcaacatcttccgaagaaagaag
gcagggacagggaatgccaattctaatggcaagtctgtgtcatggtctgaaccaggtgga
ggacagatgtccaagggacagcacatgtggcagcgcctctctgtgcacgtgaagactaat
gagacggcctgcaaccaaacagccgtcatcaagcccctcactaaaagttaccaaggctct
ggcaagagccttaccttttcagataccagcaccaagaccctttacaacgtagaggaggag
gaggatgcccagccggttcgctttagccctcctggcagcccttccatggtggtgcacagg
cgcgtgccaagcacggcgaccactccgcctctgccgccccacctgacctcagaggagact
cccctcttcctggctgacccagccctccccaagggcttgccccctcttctccagcagcag
cagcagcagccccctccacagcagaaatcgctgatggaccagctccagggagtggtcagc
aacttcagcactgcgatcccggattttcacgcggtgctggcaggccccgggggtcccggg
aacgggctgcggtccctgtaccagcccccgccacccccgcagcacctgcagatgctgcca
ctgcagctgagcaccttcgaggaggagctggtctccccgcccgcggacgacgacgacgac
agcgagaggtttaagctccttcaggagtacgtgtatgagcacgagcgggaagggaacacg
gaagaagacgaactggaagaggaggaggaggacctgcaggcggccagcaaactgaccccg
gaggattcgcctgcgctgacgcctccgtcgccttttcgcgactcggtggcctcgggcagc
tcggtgcccagctcccccgtgtccgagtcggtgctctgcacccctcccaacgtgtcctac
gcctccgtcattctgcgggactacaagcaaagctcttccaccctgtag

KEGG   Macaca mulatta (rhesus monkey): 705445
Entry
705445            CDS       T01028                                 

Gene name
GRM5
Definition
(RefSeq) metabotropic glutamate receptor 5 isoform X1
  KO
K04604  metabotropic glutamate receptor 5
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04080  Neuroactive ligand-receptor interaction
mcc04540  Gap junction
mcc04720  Long-term potentiation
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc05010  Alzheimer disease
mcc05016  Huntington disease
mcc05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    705445 (GRM5)
   04072 Phospholipase D signaling pathway
    705445 (GRM5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    705445 (GRM5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    705445 (GRM5)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    705445 (GRM5)
   04720 Long-term potentiation
    705445 (GRM5)
   04723 Retrograde endocannabinoid signaling
    705445 (GRM5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    705445 (GRM5)
   05016 Huntington disease
    705445 (GRM5)
   05022 Pathways of neurodegeneration - multiple diseases
    705445 (GRM5)
G protein-coupled receptors [BR:mcc04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   705445 (GRM5)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G DUF5438
Other DBs
NCBI-GeneID: 705445
NCBI-ProteinID: XP_014970871
Ensembl: ENSMMUG00000010184
UniProt: F6SR09
LinkDB
Position
14
AA seq 1212 aa
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS
EEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLS
DKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGI
CIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFL
LLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQ
HRFQCRLEGFPQENSKYNKTCDSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP
GYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDMILFDENGDSPGRYEIMNFKEMGKDYFD
YINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKEN
EYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVV
FIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYS
ALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIM
HDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYT
TCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTS
TVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMG
NGGRATMSSSNGKSVTWAQNEKSSRGQHLWQRLSIHINKKENPNQTAVIKPFPKSTESRG
LGAGAGAGGSAGGMGATGGAGCAGAGPGGPEPPDASPKGLYDVAETEEHFPAPTQPRSPS
PISTLSHRAGSASRTDDDVPSLHSEPAARSSSSQGSLMEQISSVVTRFTANISELNSMML
STAAPSPGVGAPLCSSYLIPKEIQLPTTMTTFAEIQPLPAIEVTGGAQPAAGAQAAGDAA
RESPAAGPEAAAAKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTL
IIRDYTQSSSSL
NT seq 3639 nt   +upstreamnt  +downstreamnt
atggtccttctgttgatcctgtcagtcttacttttgaaagaagatgtccgtgggagtgca
cagtccagtgagaggagggtggtggctcacatgccaggtgacatcattattggagctctc
ttttctgttcatcaccagcctactgtggacaaagttcatgagaggaagtgtggggcggtc
cgtgaacagtatggcattcagagagtggaggccatgctacataccctggaaaggatcaat
tcagaccctacgctcttgcccaacatcacactgggctgtgagataagggattcctgctgg
cattcggctgtggccctagagcagagcattgagttcataagagattccctcatttcttca
gaagaggaagagggcttggtacgctgtgtagatggttcctcctcttccttccgctccaag
aagcccatagtaggggtcattgggcctggctccagttctgtagccattcaggtccagaac
ttgctccagcttttcaacatacctcagattgcttattcggcaaccagcatggatctgagt
gacaagactctgttcaaatatttcatgagggttgtgccttcagatgctcagcaggcaagg
gccatggtggacatagtgaagaggtacaactggacctatgtatcagctgtgcacacagaa
ggcaactatggagaaagtgggatggaagccttcaaagatatgtcagcgaaggaagggatt
tgcatcgcccactcttacaaaatctacagtaatgcaggagagcagagctttgataagctg
ctgaagaagctcacaagtcatttgcctaaggcccgggtggtggcctgcttctgtgagggt
atgacggtgagaggtctgctgatggccatgaggcgcctgggtctagcgggagaatttctg
cttctgggcagtgatggctgggctgacaggtatgatgtgacagatggatatcagcgagaa
gctgttggtggcatcacaatcaagctccagtctcccgacgtcaagtggtttgatgattat
tatctgaagctccggccagaaacaaaccatcgaaacccttggtttcaagaattttggcag
catcgttttcagtgccgactggaagggtttccacaggagaacagcaaatacaacaagact
tgcgatagttctctgactctgaaaacacatcatgttcaggattccaaaatgggatttgtg
atcaacgccatctattcgatggcctatgggctccacaacatgcagatgtccctctgccca
ggctatgcaggactctgtgatgcaatgaagccaattgatggacggaaacttttggagtcc
ctgatgaaaaccaattttactggggtttctggagatatgatcctattcgacgagaatgga
gactctccaggaaggtatgaaataatgaatttcaaggaaatgggaaaagattattttgat
tatatcaacgttggaagttgggacaatggagaattaaaaatggatgatgatgaagtatgg
tccaagaaaagcaacatcatcagatctgtgtgcagtgaaccatgtgagaaaggccagatc
aaggtgatccgaaagggagaagtcagctgttgttggacctgtacaccttgtaaggagaat
gagtatgtctttgatgagtatacatgcaaggcatgccagctggggtcttggcccactgat
gatctcacaggttgcgatttgattccagtacagtatcttcgatggggtgaccctgaaccc
attgcagctgtggtgtttgcctgccttggcctcctagccaccctgtttgttactgtagtc
ttcatcatttaccgggatacaccagtagtcaagtcctcaagcagggaactctgttacatt
atccttgctggcatctgcctgggctacttatgtaccttctgcctcattgcaaagcccaaa
cagatttactgctaccttcagagaattggcattggtctgtccccagccatgagctactca
gcccttgtaacaaagaccaaccgtattgcaaggatcctggctggcagcaagaagaaaatc
tgtaccaaaaagcccagattcatgagtgcctgtgcccagctagtgattgctttcattctc
atatgcatccagttgggcatcattgttgccctctttataatggagcctcctgacataatg
catgactacccaagcattcgagaagtctacctgatctgtaacaccaccaacttaggagtt
gtcactccacttggatacaatggattgctgattttgagctgcaccttctatgcattcaag
accagaaatgttccagctaacttcaacgaggccaagtatatcgccttcacaatgtacacg
acctgcattatatggctagcttttgtaccaatctactttggcagcaactacaaaatcatc
accatgtgtttctcggtcagcctcagtgccacagtggccctaggctgcatgtttgtgccg
aaggtgtacatcatcctggccaaaccagagagaaatgtgcgcagcgccttcaccacatct
actgtggtgcgcatgcatgtaggggatggcaagtcatcctccgcagccagcagatccagc
agcctagtcaacctgtggaagagaaggggctcctctggggaaaccttaaggtacaaagac
aggagactggcccagcacaagtcggaaatagagtgtttcacccccaaagggagtatgggg
aatggtgggagagcaacaatgagcagctccaatggaaaatctgttacgtgggcccagaac
gagaagagcagccgggggcagcacctgtggcagcgcctgtccatccacatcaacaagaaa
gaaaatcccaaccaaacggcagtcatcaagcccttccccaagagcacggagagccgcggc
ctgggcgctggcgctggcgcaggcgggagcgcgggggggatgggggccacgggcggtgcg
ggctgcgcaggcgccggccccggcgggcccgagcccccagacgccagccccaaggggctg
tatgatgtggccgagaccgaggagcacttcccggcgcccacgcagccgcgctcaccatcg
cccatcagcacgctgagccaccgcgcgggctcggccagccgcacggacgacgacgtgccg
tcgctgcattcggagcccgctgcgcgcagcagctcgtcgcagggctccctcatggagcag
atcagcagtgtggtcacccgcttcacggccaacatcagcgagctcaactccatgatgctg
tccaccgcggcccccagccccggcgtgggcgccccgctctgctcgtcgtacctgatcccc
aaagagatccagctgcccacaaccatgacgaccttcgccgaaatccagcctctgccagcc
atcgaggtcacgggcggcgcgcagcccgcggcgggggctcaggcggctggggacgcggcc
cgggagagcccggcagcggggcccgaggctgcggccgccaagccagacctggaggagttg
gtggctctcaccccgccgtcccccttcagagactcggtggactcggggagcacaaccccc
aactcgccagtgtcggagtcggccctctgtatcccgtcgtctcccaaatatgacactctt
atcataagagattacactcagagctcctcgtcgttgtga

DBGET integrated database retrieval system