KEGG   Macaca mulatta (rhesus monkey): 698857
Entry
698857            CDS       T01028                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00562  Inositol phosphate metabolism
mcc01100  Metabolic pathways
mcc04022  cGMP-PKG signaling pathway
mcc04062  Chemokine signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04371  Apelin signaling pathway
mcc04611  Platelet activation
mcc04725  Cholinergic synapse
mcc04921  Oxytocin signaling pathway
mcc05132  Salmonella infection
mcc05145  Toxoplasmosis
mcc05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    698857 (PIK3CG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    698857 (PIK3CG)
   04072 Phospholipase D signaling pathway
    698857 (PIK3CG)
   04022 cGMP-PKG signaling pathway
    698857 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    698857 (PIK3CG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    698857 (PIK3CG)
   04062 Chemokine signaling pathway
    698857 (PIK3CG)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    698857 (PIK3CG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    698857 (PIK3CG)
  09156 Nervous system
   04725 Cholinergic synapse
    698857 (PIK3CG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    698857 (PIK3CG)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    698857 (PIK3CG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    698857 (PIK3CG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    698857 (PIK3CG)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     698857 (PIK3CG)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    698857 (PIK3CG)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 698857
NCBI-ProteinID: NP_001253687
Ensembl: ENSMMUG00000011385
UniProt: F6W7C8 G7MM34
LinkDB
Position
3
AA seq 1102 aa
MELENYEQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLH
VAGHGNVEQMKAQVWLRALETSMASDFYHRLGPDHFLLLYQKKGQWYEIYDKYQVVQTLD
CLRYWKATHRSPGQIHLVQRRPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGL
VTPRMAEVASRDPRLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDT
PGTILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNG
EEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLQIYCGKAPAVSSKASAESPSSESKGKVQLLYYVNLLLIDHRFLLRRGEY
VLHMWQISGKGEDQGSFSADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQKLENLQNSQLP
KSFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFQKFQDTCVKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt   +upstreamnt  +downstreamnt
atggagctggagaactatgaacagcccgtggtgctgagagaggacaactgccgcaggcgc
cggaggatgaagccgcgcagtgctgcggccagcctgtcctccatggagctcatccccatc
gagttcgtgctgcccaccagccagcgcaaatgcaagagccccgaaacggcgctgctgcac
gtggcgggccacggcaacgtggagcagatgaaggcccaggtgtggctgcgagcgctggag
accagcatggcgtcggacttctaccaccgactggggccggaccacttcctcctgctctac
cagaagaaggggcagtggtatgagatctacgacaagtaccaggtggtgcagactctggac
tgcctgcgctactggaaggccactcaccggagcccgggccagatccacctggtgcagcgg
cgcccgccctctgaggagtcgcaggccttccagcggcagctcaccgcgctgattggctat
gatgtcaccgacgtcagcaacgtgcacgacgacgagctggagttcacgcgccgcggcctg
gtgacgccgcgcatggcggaggtggccagtcgcgacccgaggctctacgccatgcacccc
tgggtgacgtccaagcccctcccggagtacctgtggaagaagattgccaacaactgcatc
ttcatcgtcattcaccgcagcaccaccagccagaccattaaggtctcgcccgacgacacc
cctggaaccatcctgcagagcttcttcaccaagatggccaagaagaaatctctgatggat
attcctgaaagccaaagcgaacaggattttgtgctgcgcgtctgtggccgggatgagtac
ctggtgggcgaaacgcccatcaaaaacttccagtgggtgaggcactgcctcaagaacgga
gaagaaattcacctggtactggacacgcctccagacccggccctagacgaggtaaggaag
gaagagtggccactggtggatgactgcacaggagtcactggctaccatgagcagctgacc
atccacggcaaggaccacgagagtgtgttcaccgtgtccctgtgggactgcgaccgcaag
ttcagggtcaagatcagaggcattgatatccccgtcctgccccggaacaccgacctcaca
gtttttgtagaggcaaacatccagcatgggcagcaagtcctttgccaaaggagaaccagc
cccaaacccttcacagaggaggtgctctggaatgtgtggcttgagttcagtatcaaaatc
aaagacttgcccaaaggagctctactgaacctccagatctactgtggtaaagctccagca
gtgtccagcaaggcctctgcagagtcccccagttctgagtccaagggcaaagttcagctt
ctctattatgtgaacctgctgctgatagaccaccggttccttctgcgccgtggagaatac
gttctccacatgtggcagatatccgggaagggagaagaccaaggaagcttcagtgctgac
aaactcacgtctgcaactaacccagacaaggagaactcaatgtccatctccattcttctg
gacaattactgccacccgatagccctgcctaagcatcagcccacccctgacccagaaggg
gaccgggttcgagcagaaatgcccaaccagcttcgcaagcaattggaggcgatcatagct
actgatccacttaaccctctcacagcagaggacaaagaattgctctggcactttagatat
gaaagccttaagcacccaaaagcatatcctaagctatttagttcagtgaaatggggacag
caagaaattgtggccaaaacataccaattgttggccagaagggaagtctgggatcaaagt
gctttggatgttgggttaacaatgcagctcctggactgcaacttctcagatgaaaatgta
agagccattgcagttcagaaactggagagcttggaggacgatgatgttctgcattacctt
ctacagttggtacaggctgtgaaatttgaaccataccatgatagcgcccttgccagattt
ctgctgaagcgtggtttaagaaacaaaagaattggtcactttttgttttggttcttgaga
agtgagatagcccagtccagacactatcagcagaggttcgccgtgattctggaagcctat
ttgaggggctgtggcacagccatgctgcacgactttacccaacaagtccaagtaatcgag
atgttacaaaaagtcacccttgatattaaatcgctctctgctgaaaagtatgatgtcagt
tcccaagttatttcacaacttaaacaaaagcttgaaaacctgcagaattctcaactcccc
aaaagctttagagttccatatgatcctggactgaaagcaggagcgctggcaattgaaaaa
tgtaaagtaatggcctccaagaaaaaaccactgtggcttgagtttaaatgtgccgatcct
acagccctatcaaatgaaacaattggaattatatttaaacatggtgatgatctgcgccaa
gacatgcttattttacagattctacgaatcatggagtccatttgggagactgaatctttg
gatctgtgcctcctgccatatggttgcatttcaactggtgacaaaataggaatgatcgag
attgtgaaagacgccacaacaattgccaaaattcagcaaagcaccgtgggcaacacggga
gcatttaaagatgaagtcctgaatcactggctcaaagaaaaatctcctactgaagaaaag
tttcaggcagcagtggagagatttgtttattcctgtgcaggctactgtgtggcaaccttt
gttcttggaataggcgacagacacaatgacaatattatgatcacagagacaggaaaccta
tttcatattgacttcgggcacattcttgggaattacaaaagtttcctgggcattaataaa
gagagagtgccatttgtgctaacccctgacttcctgttcgtcatgggaacttctggaaag
aagacaagcctacacttccagaaatttcaggacacctgtgttaaggcttatctagccctt
cgtcatcacacaaacctactgatcatcctgttctccatgatgctgatgaccggaatgccc
cagttaacaagcaaagaagacattgaatatatccgggatgccctcacagtggggaaaaat
gaggaggatgctaaaaagtattttcttgatcagatcgaagtgtgcagagacaaaggatgg
actgtgcagtttaattggtttctacatcttgttcttggcatcaaacaaggagaaaaacat
tcagcctaa

KEGG   Macaca mulatta (rhesus monkey): 722023
Entry
722023            CDS       T01028                                 

Gene name
PIK3R6
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 6
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04062  Chemokine signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04371  Apelin signaling pathway
mcc04611  Platelet activation
mcc04725  Cholinergic synapse
mcc04921  Oxytocin signaling pathway
mcc05145  Toxoplasmosis
mcc05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    722023 (PIK3R6)
   04072 Phospholipase D signaling pathway
    722023 (PIK3R6)
   04022 cGMP-PKG signaling pathway
    722023 (PIK3R6)
   04151 PI3K-Akt signaling pathway
    722023 (PIK3R6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    722023 (PIK3R6)
   04062 Chemokine signaling pathway
    722023 (PIK3R6)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    722023 (PIK3R6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    722023 (PIK3R6)
  09156 Nervous system
   04725 Cholinergic synapse
    722023 (PIK3R6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    722023 (PIK3R6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    722023 (PIK3R6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    722023 (PIK3R6)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    722023 (PIK3R6)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 722023
NCBI-ProteinID: XP_014974072
Ensembl: ENSMMUG00000005791
UniProt: F6UB42
LinkDB
Position
16
AA seq 754 aa
MESSDVELDLQRSVHAVLRELSTQAPALQSNQGMWRWSLHKKVERDPGKSPALVRILLRE
LEKAESEDLRHVIIPLLHTVMYVLTKATGITEELYQRIYAFCTRLLTLPTPYCTVALDCA
IRLKTETAVPGTLYQRMVIAEQNLMNELYPYQERVFLFVDPELVSASVCSALLLEIEAAQ
EQQTPEACMRHVVSHALQAALGEACHAGALHRKLQASPRHTLEQYFHAVVAAVEQMASEA
SPSREGHVERLEEIYCSLLGPAAGRRGGDPVQERPPSIPLPSPYITFHLWTGEEQLWKEL
VLFLRPRSQLRLSADLEVLDLQGLRPDRELARVSVLSTDSGIERDLPPGADELPAPSSPE
MERAGLKRKGGIKKRAWPLDFLMPGGWDGPPGLHRRTGRPGGDGEVLPGVSRLHTARVLV
LGDDRMLGRLAQAYHRLRKRETQKFCLTPRLSLQLYYIPVLAPEKPAASRQPELGELATF
LGRADPWYQSNVNTLCPAIHKLAEMPPSLDSSQTVDPFILDVITYYIRMGTQPIYFQIYT
VKIFFSDLSQDPTEDIFLIELKVKIQDSKFPKDGFSPRRRGVAEGPGAELSLCYQKALLS
HRPQEVTVSLRATGVVLKAIPASDTEVSGSRHCPLPAAPVTDHSCLNVSVTEVVKSSNLA
GKSFSMVTNTFRTNHIQIQSQDQRPLTLSLDKDDQRTFRNVVRFEVAPCPEPCSGAQKSK
APWLNLHGQQEMEATKATPKPLLMPINTFSGIVQ
NT seq 2265 nt   +upstreamnt  +downstreamnt
atggagagctcagacgtggagctggacctccagaggagcgtgcatgctgtgctccgggag
ctcagcacccaggcccctgccctgcagagcaaccaaggcatgtggaggtggtccctgcac
aagaaggtcgagcgagatcctggtaagagcccggcgctggtccgcattctgctcagagaa
ctggagaaggcggaaagcgaggacctccggcatgtcatcattcccttgctgcacactgta
atgtacgtgctcaccaaggccacaggaatcacagaggagctctaccagagaatctacgcc
ttttgcacgaggttactgaccctgcccaccccctactgcacagtcgccttggactgcgcc
ataaggttgaaaacagagacggccgtcccagggaccctctaccaaaggatggtcattgcc
gaacagaacttgatgaatgaactgtatccctaccaggagagagtgtttctcttcgtggat
cctgagctggtgtctgcctccgtgtgcagtgctctgctactggagatcgaggcggcccag
gagcagcagacaccagaggcctgcatgcgccacgtggtctcccacgccctgcaggcggct
ctgggggaagcctgtcacgcaggcgctctgcacaggaagctgcaggccagccctcgccac
accctggaacagtatttccacgccgtggtggccgccgtggagcagatggccagtgaggcc
agcccgagccgggagggacacgtggagaggctggaggagatttactgctcgctgctgggg
cccgcggcgggacgcagaggtggtgaccctgtccaagagcggccaccaagcattcccctg
cccagcccctacatcaccttccacctgtggaccggcgaggagcagctctggaaggaactg
gtgctcttcctccgcccaagatcccagctgcgtctcagtgctgacttggaggtcttggat
ctgcagggcctccggccagaccgggagttggcccgggtttccgtgctgtccacggacagc
ggcatcgagcgggaccttcccccgggggctgatgagctgcctgcacccagcagccctgag
atggagcgagctgggctgaagcgcaaagggggcatcaagaaacgtgcgtggcccctggac
ttcttgatgcctggcggctgggacgggcccccagggctgcaccggaggacaggcaggccc
ggtggggatggggaagtgctgcccggtgtctcccggctgcacacagcccgggtacttgtg
ctgggagacgacaggatgctggggcgcctggcccaggcctaccacagactcaggaaacgg
gagacccagaagttctgcctcactcccagactcagcctgcagctctactacatccccgtg
ctggcacctgagaagcctgcagcatccaggcagccagagctgggagagctggctacgttc
ctgggccgcgcagacccgtggtaccagagcaacgtcaacacgctgtgccccgccatccac
aagctggctgagatgcctccttccctggactcatcccagactgtggaccccttcatccta
gacgtcatcacctactacatccgcatgggcacccaacccatctatttccagatctacaca
gtcaagatcttcttcagtgacctgagccaagaccctaccgaggacatcttcctcattgag
ctgaaggtgaagatccaagattctaaattccccaaagatggcttttcacccaggaggaga
ggcgtggccgagggcccaggggcggagctctccctgtgctaccagaaggccttgctcagc
caccggccccaagaggtcactgtttccctgcgggccactggggtggtcctgaaggccatt
ccagccagcgatacagaagtttcagggtctcgccattgccccctgcctgctgctcctgtc
acagaccactcgtgtctgaatgtcagcgtgacagaggttgtcaagtcctccaacttggcg
ggaaagtccttctctatggtgaccaacaccttcaggacgaaccatatccagatccagagc
caggaccagaggccgctgacattgtcactggacaaggacgatcaacgcactttcaggaac
gtggtcagattcgaggttgctccctgcccagaaccatgttccggggcccagaagtccaag
gcgccgtggctcaatttgcacgggcaacaggagatggaagcgaccaaagccacacccaag
ccccttctgatgcccatcaacacattctctggcattgtccagtga

KEGG   Macaca mulatta (rhesus monkey): 722027
Entry
722027            CDS       T01028                                 

Gene name
PIK3R5
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 5 isoform X1
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04062  Chemokine signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04371  Apelin signaling pathway
mcc04611  Platelet activation
mcc04725  Cholinergic synapse
mcc04921  Oxytocin signaling pathway
mcc05145  Toxoplasmosis
mcc05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    722027 (PIK3R5)
   04072 Phospholipase D signaling pathway
    722027 (PIK3R5)
   04022 cGMP-PKG signaling pathway
    722027 (PIK3R5)
   04151 PI3K-Akt signaling pathway
    722027 (PIK3R5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    722027 (PIK3R5)
   04062 Chemokine signaling pathway
    722027 (PIK3R5)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    722027 (PIK3R5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    722027 (PIK3R5)
  09156 Nervous system
   04725 Cholinergic synapse
    722027 (PIK3R5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    722027 (PIK3R5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    722027 (PIK3R5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    722027 (PIK3R5)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    722027 (PIK3R5)
SSDB
Motif
Pfam: PI3K_1B_p101 DUF2284 ApoC-I BUD22
Other DBs
NCBI-GeneID: 722027
NCBI-ProteinID: XP_014974074
Ensembl: ENSMMUG00000005792
UniProt: H9Z760
LinkDB
Position
16
AA seq 881 aa
MQPGATTCTEDRIQHALERCLHGLSLGRRSTSWSAGLCLNCWSLQELVSRDPGHFLILLE
QILQKTREVQEKGTYDLLTPLALLFYSTVLCTPHFPPDSDLLLKAASTYHRFLTWPVPYC
SICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSSTVTVLLLNPVEVQAEFLAVAN
KLSTPGHSPHSAYTTLLLHAFQATFGAHCDVPGLHCRLQAKTLAELEDIFTETAEAQELA
SGIGDAAEARRWLRTKLQAVGEKAGFPGVLDTAKPGKLHTIPIPVARCYTYSWNQDSFDI
LQEILLKEQELLQPGILADDEEEEEEEEEEEEEDLETDGHCAERDSLLSTSSLASHDSTL
SLTSSQASGPALSRHLLTSFVSGLSDGMDSGYVEDSEESSSEWPRRRGSQERRGHRRPGQ
KFIRIYKLFKSTSQLVLRRDSRSLEGNSDTALPLRRAGSLCSPLDDPVSPPSRAQRSRSL
PQPKLSTQLPSWLLAPASRHQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSNLR
RLENNRPLLTRFFKLQFFYVPVKRSHGTSPGACPPPRSQTPSPPTDSPRHASPGELGTTP
WEESTNDISHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKAEAQALEGSPTQLPILADML
LYYCRFAARPVLLQVYQTELTFITGEKTTEIFIHSLELGHSAATRAIKASGPGSKRLGID
DDREAVPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTE
VVKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCY
KPEKSDLSSPPQRPPNLPAQAAPDLCSLLCLPIMTFSGALP
NT seq 2646 nt   +upstreamnt  +downstreamnt
atgcagccaggggccacgacatgcacagaggaccgcatccagcatgccctggaacgctgc
ctgcacggactcagcctcggccgccgctccacctcctggtcagctgggctgtgtctgaac
tgctggagcctgcaggagctggtcagcagagacccgggccacttccttatcctccttgag
cagatcctgcagaagacgcgagaggtccaggagaagggcacctacgacctgctcaccccc
ctggccctgctcttctattccactgttctttgtacaccacacttcccaccagactcggat
cttcttctgaaggcagccagcacctaccaccggttcctgacctggcctgttccttactgc
agcatctgccaggagctgctcaccttcattgatgctgaactcaaggccccagggatctcc
taccagaggctggtgagggctgagcagggcctgcccatcaggagtcaccgcagctccacc
gtcaccgtgctgttgctgaacccagtagaagtgcaggccgagttcctcgctgtagccaat
aagctgagcacccccggacactcgcctcacagtgcctacaccaccctgctcctgcatgcc
ttccaggccacctttggggcccactgtgacgtcccgggcctgcactgcaggctgcaggcc
aagaccctggcagagcttgaggacatcttcacggagaccgcagaggcacaggagctggca
tctggcatcggagatgctgcagaggcccggcggtggctcaggaccaagctgcaggcggtg
ggagaaaaagctggcttccctggggtgttagacactgcaaaaccagggaagctccatacc
atccccatccctgttgcccggtgttacacctacagctggaaccaggacagctttgacatc
ctgcaggaaatcctgctcaaggaacaggagctgctccagccagggatcctggcagatgat
gaagaggaggaggaggaagaggaggaggaggaggaggaggacttggaaacggatgggcat
tgtgccgagagagactccctgctctccaccagctctttggcgtcccacgactccaccctg
tccctcacatcctcccaggcctcagggccggccctctcgcgccatctgctgacttccttt
gtctcaggcctctcggatggcatggacagcggctacgtggaggacagcgaggagagctcc
tccgagtggcccaggaggcgcggcagccaggaacgccggggccaccgcaggcctgggcag
aagttcatcaggatctataaactcttcaagagcactagccagctggtactgcggagggac
tctcggagcctggagggcaactcggacacggccctgcccctgcggcgggcagggagcctc
tgcagccccctggacgatccagtatcgcccccttcccgggcccagcgctcccgctccctg
ccccagcccaaactcagtacccagctgcccagctggcttctagcccccgcttcacgtcac
cagcgccgccgccccttcctgagtggagatgaggatcccaaggcctccacgctacgtgtt
gtggtctttggctccgatcggatttcagggaaggtggcccgggcatacagcaaccttcgg
cggctggagaacaatcgcccactcctcacacggttcttcaaacttcagttcttctatgtg
cctgtgaagcgaagtcacgggaccagccctggtgcctgtccaccccctcggagccagacg
ccctcacccccgacagactcccctaggcacgccagccctggagagctgggcaccacccca
tgggaggagagcaccaatgacatctcccactacctcggcatgctggacccctggtatgag
cgcaatgtgctaggcctcatgcacctgccccctgaagttctgtgccagcagtccctgaag
gctgaagcccaggccctggagggctcccccacccagctgcccatcctggccgacatgcta
ctctactactgccgctttgccgccagaccggtgctgctgcaagtctatcagacggagctg
accttcatcactggggagaagacgacagagatcttcatccactccttggagctgggtcac
tccgctgccacacgtgccatcaaggcttcgggtcctggcagcaagcggctgggcatcgat
gacgaccgggaggctgttcctctaacactacagattatttacagcaagggggctatcagt
ggacgaagtcgctggagcaacctggagaaggtctgtacctccgtgaaccttaacaaggcc
tgccggaagcaggaggagctggattccagcatggaggccctgacgctaaacctgacagaa
gtagtgaaaaggcagaactccaaatccaagaagggctttaaccagattagcacatcgcag
atcaaagtggacaaggtgcagatcatcggttccaacagctgcccgttcgctgtgtgcctg
gaccaggatgagaggaagatcctgcagagtgtagtcagatgtgaggtttcaccctgctac
aagccggagaagagcgacctctcctcgccaccccagaggcctcccaacctgccggcccag
gccgcgcctgatctctgctcccttctctgcctgcccatcatgactttcagtggagctctg
ccctag

DBGET integrated database retrieval system