KEGG   Macaca mulatta (rhesus monkey): 698859Help
Entry
698859            CDS       T01028                                 

Definition
(RefSeq) putative trypsin-6
Organism
mcc  Macaca mulatta (rhesus monkey)
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 698859
NCBI-ProteinID: XP_014990600
Ensembl: ENSMMUG00000046704
LinkDB All DBs
Position
3
AA seq 296 aa AA seqDB search
MQDPGKGKAAGLLVLRGAVTLTSQTLPLPILGRYKDWSSTTSQGHSTTMNPLLILAFVGA
AVAAPFDDDDKIVGGYTCEENSVPYQVSLNYGYHFCGGSLINKQWVVSAAHCYKPRIQVR
LGEHNIEVLEGTEQFINAAKIIPHPKYNEVKKYNNDIMLIKLSTPAVINARVSTISLPTA
PPAPGTVCLISGWGNTLSSGADYPDELKCLDAPVLTQAECEASYPGKITSNMFCVGFLEG
GKDSCQGDSGGPVVYNGQLQGVVSWGYGCAQKNRPGVYTKVYNYLAWIKDTIAANS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaccctgggaaggggaaagctgcaggtttgttggtcctacgaggagcagtgacc
ctcacctcacagacacttcctctcccaatcctcgggaggtataaagactggtcctccacc
accagtcagggacactctaccaccatgaatccactcctgatccttgcctttgtgggagcg
gctgttgctgccccctttgacgatgatgacaagatcgttggaggctacacctgtgaggag
aattctgtcccctaccaggtgtccctgaattatggctaccacttctgtggtggctccctc
attaacaaacagtgggtggtgtcagcagctcactgctacaagccccgcatccaggtgaga
ctgggagagcataacatcgaagtcctggaggggactgagcaattcatcaatgcagccaag
atcatcccgcaccccaaatacaacgaggttaagaaatataacaatgacatcatgctgatc
aagctttccacacctgctgtcatcaatgcccgtgtgtccaccatctctctgcccactgcc
cctccagctcctggcactgtgtgcctcatctctggctggggcaacactctgagctctggc
gccgactacccagatgagctgaagtgcctggacgctcctgtgctgacccaggctgagtgt
gaagcctcctaccctggaaagattaccagtaacatgttctgtgtgggcttccttgaggga
ggcaaggattcctgccagggcgactctggtggacctgtggtctacaacggacagctccaa
ggagttgtgtcctggggctatggctgtgcccagaagaacaggcctggagtctacaccaag
gtctacaactatttggcctggattaaggacaccatagctgccaacagctaa

DBGET integrated database retrieval system