KEGG   Macaca mulatta (rhesus monkey): 698931
Entry
698931            CDS       T01028                                 

Gene name
SLC2A1
Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 1
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04066  HIF-1 signaling pathway
mcc04911  Insulin secretion
mcc04919  Thyroid hormone signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04922  Glucagon signaling pathway
mcc04931  Insulin resistance
mcc04976  Bile secretion
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
mcc05211  Renal cell carcinoma
mcc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    698931 (SLC2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    698931 (SLC2A1)
   04922 Glucagon signaling pathway
    698931 (SLC2A1)
   04920 Adipocytokine signaling pathway
    698931 (SLC2A1)
   04919 Thyroid hormone signaling pathway
    698931 (SLC2A1)
  09154 Digestive system
   04976 Bile secretion
    698931 (SLC2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    698931 (SLC2A1)
   05230 Central carbon metabolism in cancer
    698931 (SLC2A1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    698931 (SLC2A1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    698931 (SLC2A1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    698931 (SLC2A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcc02000]
    698931 (SLC2A1)
Transporters [BR:mcc02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   698931 (SLC2A1)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    698931 (SLC2A1)
SSDB
Motif
Pfam: Sugar_tr MFS_1 DUF2127 DUF523 TRI12
Other DBs
NCBI-GeneID: 698931
NCBI-ProteinID: NP_001244791
Ensembl: ENSMMUG00000000373
UniProt: F6YFI2
LinkDB
Position
1
AA seq 492 aa
MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWIHRYGERILPTT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIM
GNEDLWPLLLSIIFVPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHD
LQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLEQ
LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
ELFHPLGADSQV
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggagcccagcagcaagaagttgacgggtcgcctcatgctggccgtgggaggagcagtg
cttggctccctgcagtttggctacaacactggagtcatcaatgcgccccagaaggtgatt
gaggagttctacaaccagacatggatccaccgctatggggagcgcatcctgcccaccaca
ctcaccacactctggtccctctctgtggccatattctccgttgggggcatgattggctcc
ttctctgtgggccttttcgttaaccgctttggccggcggaattcaatgctgatgatgaac
ctgctggccttcgtgtctgccgtgctcatgggcttctcgaaactgggcaagtcctttgag
atgctgatcctgggccgcttcatcatcggtgtgtactgcggcctgaccacaggcttcgtg
cccatgtatgtgggtgaggtgtcacccacagcccttcgtggggccctgggcaccctgcac
cagctgggcatcgtcgttggcatcctcattgcccaggtgttcggcctggactccatcatg
ggcaacgaggacctgtggcccctgctgctgagcatcatcttcgtcccagccctgctgcag
tgcatcgtgctgcccttctgccccgagagcccccgcttcctgctcatcaaccgcaatgag
gagaaccgggccaagagtgtgctgaagaagctgcgcgggacggctgacgtgacccatgac
ctgcaggagatgaaggaagagagtcggcagatgatgcgggagaagaaggtcaccatcctg
gagctgttccgctcccccgcctaccgccagcccatcctcattgctgtggtgctgcagctg
tcccagcagctgtcgggcatcaatgctgtcttctattactccacgagcatctttgagaag
gcaggggtgcagcagcctgtgtacgccaccattggctccggcatcgtcaacacggccttc
actgttgtgtcgctgtttgtggtggagcgagcaggccggcggaccctgcatctcataggc
ctggctggcatggcaggttgtgccatactcatgaccatcgcgctggcactgctggagcaa
ctaccctggatgtcctatctgagcatcgtagccatctttggctttgtggccttctttgaa
gtgggtcctggccccattccatggttcatcgtggctgaactcttcagccagggtccacgt
ccagctgccattgctgttgcaggcttctccaactggacctcaaatttcattgtgggcatg
tgcttccagtatgtggagcaactatgtggtccctacgtcttcatcatcttcactgtgctc
ctggttctgttcttcatcttcacctacttcaaagttcccgagactaaaggccggaccttc
gatgagattgcttccggcttccggcaggggggagccagccaaagtgacaagacacccgag
gagctgttccatcccctgggggctgattcccaagtgtga

DBGET integrated database retrieval system