KEGG   Macaca mulatta (rhesus monkey): 698996
Entry
698996            CDS       T01028                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc01524  Platinum drug resistance
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04070  Phosphatidylinositol signaling system
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04140  Autophagy - animal
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04210  Apoptosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04218  Cellular senescence
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04380  Osteoclast differentiation
mcc04510  Focal adhesion
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04611  Platelet activation
mcc04613  Neutrophil extracellular trap formation
mcc04620  Toll-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04668  TNF signaling pathway
mcc04670  Leukocyte transendothelial migration
mcc04722  Neurotrophin signaling pathway
mcc04725  Cholinergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04810  Regulation of actin cytoskeleton
mcc04910  Insulin signaling pathway
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04917  Prolactin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04926  Relaxin signaling pathway
mcc04929  GnRH secretion
mcc04930  Type II diabetes mellitus
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc04960  Aldosterone-regulated sodium reabsorption
mcc04973  Carbohydrate digestion and absorption
mcc05010  Alzheimer disease
mcc05017  Spinocerebellar ataxia
mcc05020  Prion disease
mcc05100  Bacterial invasion of epithelial cells
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05146  Amoebiasis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05211  Renal cell carcinoma
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    698996 (PIK3R1)
   04014 Ras signaling pathway
    698996 (PIK3R1)
   04015 Rap1 signaling pathway
    698996 (PIK3R1)
   04370 VEGF signaling pathway
    698996 (PIK3R1)
   04630 JAK-STAT signaling pathway
    698996 (PIK3R1)
   04668 TNF signaling pathway
    698996 (PIK3R1)
   04066 HIF-1 signaling pathway
    698996 (PIK3R1)
   04068 FoxO signaling pathway
    698996 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    698996 (PIK3R1)
   04072 Phospholipase D signaling pathway
    698996 (PIK3R1)
   04071 Sphingolipid signaling pathway
    698996 (PIK3R1)
   04024 cAMP signaling pathway
    698996 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    698996 (PIK3R1)
   04152 AMPK signaling pathway
    698996 (PIK3R1)
   04150 mTOR signaling pathway
    698996 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    698996 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    698996 (PIK3R1)
   04218 Cellular senescence
    698996 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    698996 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    698996 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    698996 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    698996 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    698996 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    698996 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    698996 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    698996 (PIK3R1)
   04660 T cell receptor signaling pathway
    698996 (PIK3R1)
   04662 B cell receptor signaling pathway
    698996 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    698996 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    698996 (PIK3R1)
   04670 Leukocyte transendothelial migration
    698996 (PIK3R1)
   04062 Chemokine signaling pathway
    698996 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    698996 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    698996 (PIK3R1)
   04929 GnRH secretion
    698996 (PIK3R1)
   04915 Estrogen signaling pathway
    698996 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    698996 (PIK3R1)
   04917 Prolactin signaling pathway
    698996 (PIK3R1)
   04926 Relaxin signaling pathway
    698996 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    698996 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    698996 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    698996 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    698996 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    698996 (PIK3R1)
   04722 Neurotrophin signaling pathway
    698996 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    698996 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    698996 (PIK3R1)
   04380 Osteoclast differentiation
    698996 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    698996 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    698996 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    698996 (PIK3R1)
   05206 MicroRNAs in cancer
    698996 (PIK3R1)
   05205 Proteoglycans in cancer
    698996 (PIK3R1)
   05203 Viral carcinogenesis
    698996 (PIK3R1)
   05230 Central carbon metabolism in cancer
    698996 (PIK3R1)
   05231 Choline metabolism in cancer
    698996 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    698996 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    698996 (PIK3R1)
   05212 Pancreatic cancer
    698996 (PIK3R1)
   05225 Hepatocellular carcinoma
    698996 (PIK3R1)
   05226 Gastric cancer
    698996 (PIK3R1)
   05214 Glioma
    698996 (PIK3R1)
   05221 Acute myeloid leukemia
    698996 (PIK3R1)
   05220 Chronic myeloid leukemia
    698996 (PIK3R1)
   05218 Melanoma
    698996 (PIK3R1)
   05211 Renal cell carcinoma
    698996 (PIK3R1)
   05215 Prostate cancer
    698996 (PIK3R1)
   05213 Endometrial cancer
    698996 (PIK3R1)
   05224 Breast cancer
    698996 (PIK3R1)
   05222 Small cell lung cancer
    698996 (PIK3R1)
   05223 Non-small cell lung cancer
    698996 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    698996 (PIK3R1)
   05017 Spinocerebellar ataxia
    698996 (PIK3R1)
   05020 Prion disease
    698996 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    698996 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    698996 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    698996 (PIK3R1)
   04931 Insulin resistance
    698996 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    698996 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    698996 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    698996 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    698996 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    698996 (PIK3R1)
   05161 Hepatitis B
    698996 (PIK3R1)
   05160 Hepatitis C
    698996 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    698996 (PIK3R1)
   05164 Influenza A
    698996 (PIK3R1)
   05162 Measles
    698996 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    698996 (PIK3R1)
   05163 Human cytomegalovirus infection
    698996 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    698996 (PIK3R1)
   05169 Epstein-Barr virus infection
    698996 (PIK3R1)
   05165 Human papillomavirus infection
    698996 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    698996 (PIK3R1)
   05142 Chagas disease
    698996 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    698996 (PIK3R1)
   01524 Platinum drug resistance
    698996 (PIK3R1)
   01522 Endocrine resistance
    698996 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    698996 (PIK3R1)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    698996 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 SH3_2 Laminin_I Lant_dehydr_C FANCI_S2 PI_PP_I Mod_r Bap31_Bap29_C
Other DBs
NCBI-GeneID: 698996
NCBI-ProteinID: NP_001248126
Ensembl: ENSMMUG00000011532
UniProt: H9ZA51
LinkDB
Position
6
AA seq 724 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAE
QFAPPDVAPPLLIKLVEAIEKKGLECSTLYRTQSSGNLAELRQLLDCDTASVDLEMIDVH
ILADAFKRYLLDLPNPVIPAAVYSEMISLAQEVQSSEEYIQLLKKLIRSPSIPHQYWLTL
QYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIID
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgctgaggggtaccagtacagagcgctgtatgattataaaaaagaaagagaagaa
gatattgacttgcacttgggtgacatattgactgtgaataaagggtccttagtagctctt
ggattcagtgatggacaggaagccaggcctgaagaaattggctggttaaatggctataat
gaaaccacaggggaaaggggggactttccgggaacttatgtagaatatattggaaggaaa
aaaatctcgcctcccacgccaaagccccggccgcctcggcctcttcctgttgcaccaggt
tcttcgaaaactgaagcagatgttgaacaacaagctttgactctcccggatcttgcagag
cagtttgcccctcctgacgttgccccacctcttcttatcaagctcgtggaagccattgaa
aagaaaggtctggaatgttcaactctatacagaacacagagctccggcaacctggcggaa
ttacgacagcttcttgattgtgatacagcctctgtggacttggaaatgatcgatgtgcac
attttggccgatgctttcaaacgctatctcctggacttaccaaatcctgtcattccagca
gccgtttacagtgaaatgatttctttagctcaagaagtacaaagctccgaagaatatatt
cagctactgaagaagcttattaggtcgcctagcatacctcatcagtattggcttacgctt
cagtatttgttaaaacatttcttcaagctctctcaaacctccagcaaaaatctgttgaat
gcaagagtactctctgaaattttcagccctatgcttttcagattctcagcagccagctcc
gataatactgaaaacctcataaaagttatagaaattttaatctcaactgaatggaatgaa
cgacagcctgcaccagcactgcctcctaaaccaccaaaacccactactgtagccaacaac
ggtatgaataacaatatgtccttacaagatgctgaatggtactggggagatatctcgagg
gaagaagtgaatgaaaaacttcgagatacagcagatgggacctttttggtacgagatgcg
tctactaaaatgcatggtgattatactcttacactaaggaaagggggaaataacaaatta
atcaaaatatttcatcgagatgggaaatatggcttctctgacccattaaccttcaattct
gtggttgaattaataaaccactaccggaatgaatctctagctcagtataatcccaagctg
gatgtgaaattactttatccagtatccaaataccaacaggatcaagttgtcaaagaagat
aatattgaagctgtagggaaaaaattacatgaatataacactcagtttcaagaaaaaagc
agagaatatgatagattatatgaagaatatacccgtacatcccaggaaatccaaatgaaa
aggacagctattgaagcatttaatgaaaccataaaaatatttgaagaacagtgccagacc
caggagcgctacagcaaagaatacatagaaaagtttaaacgtgagggcaatgagaaagaa
atacaaaggattatgcataattatgataagttgaagtctcgaatcagtgaaattattgac
agtagaagaagattggaagaagacttgaagaagcaggcagctgagtatcgagaaattgac
aaacgtatgaacagcattaaaccagaccttatccagctgagaaagacgagagaccaatac
ttgatgtggttgactcaaaaaggtgttcggcaaaagaagttgaacgagtggttgggcaat
gaaaacactgaagaccaatattcgctggtggaagatgatgaagatttaccccatcatgat
gagaagacgtggaatgttggaagcagcaaccgaaacaaagctgaaaacctgttgcgaggg
aagcgagatggcacttttcttgtccgggagagcagtaaacagggctgctacgcctgctct
gtagtggtggacggcgaagtaaagcattgtgtcataaacaaaacagcgactggctatggc
tttgccgagccctataacttgtacagctctctgaaagaactggtgctacattaccaacac
acctccctcgtgcagcacaacgactccctcaatgtcacactagcctacccagtatatgca
cagcagaggcgatga

KEGG   Macaca mulatta (rhesus monkey): 707310
Entry
707310            CDS       T01028                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc01524  Platinum drug resistance
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04070  Phosphatidylinositol signaling system
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04140  Autophagy - animal
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04210  Apoptosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04218  Cellular senescence
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04380  Osteoclast differentiation
mcc04510  Focal adhesion
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04611  Platelet activation
mcc04613  Neutrophil extracellular trap formation
mcc04620  Toll-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04668  TNF signaling pathway
mcc04670  Leukocyte transendothelial migration
mcc04722  Neurotrophin signaling pathway
mcc04725  Cholinergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04810  Regulation of actin cytoskeleton
mcc04910  Insulin signaling pathway
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04917  Prolactin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04926  Relaxin signaling pathway
mcc04929  GnRH secretion
mcc04930  Type II diabetes mellitus
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc04960  Aldosterone-regulated sodium reabsorption
mcc04973  Carbohydrate digestion and absorption
mcc05010  Alzheimer disease
mcc05017  Spinocerebellar ataxia
mcc05020  Prion disease
mcc05100  Bacterial invasion of epithelial cells
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05146  Amoebiasis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05211  Renal cell carcinoma
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    707310 (PIK3R3)
   04014 Ras signaling pathway
    707310 (PIK3R3)
   04015 Rap1 signaling pathway
    707310 (PIK3R3)
   04370 VEGF signaling pathway
    707310 (PIK3R3)
   04630 JAK-STAT signaling pathway
    707310 (PIK3R3)
   04668 TNF signaling pathway
    707310 (PIK3R3)
   04066 HIF-1 signaling pathway
    707310 (PIK3R3)
   04068 FoxO signaling pathway
    707310 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    707310 (PIK3R3)
   04072 Phospholipase D signaling pathway
    707310 (PIK3R3)
   04071 Sphingolipid signaling pathway
    707310 (PIK3R3)
   04024 cAMP signaling pathway
    707310 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    707310 (PIK3R3)
   04152 AMPK signaling pathway
    707310 (PIK3R3)
   04150 mTOR signaling pathway
    707310 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    707310 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    707310 (PIK3R3)
   04218 Cellular senescence
    707310 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    707310 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    707310 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    707310 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    707310 (PIK3R3)
   04613 Neutrophil extracellular trap formation
    707310 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    707310 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    707310 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    707310 (PIK3R3)
   04660 T cell receptor signaling pathway
    707310 (PIK3R3)
   04662 B cell receptor signaling pathway
    707310 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    707310 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    707310 (PIK3R3)
   04670 Leukocyte transendothelial migration
    707310 (PIK3R3)
   04062 Chemokine signaling pathway
    707310 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    707310 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    707310 (PIK3R3)
   04929 GnRH secretion
    707310 (PIK3R3)
   04915 Estrogen signaling pathway
    707310 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    707310 (PIK3R3)
   04917 Prolactin signaling pathway
    707310 (PIK3R3)
   04926 Relaxin signaling pathway
    707310 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    707310 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    707310 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    707310 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    707310 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    707310 (PIK3R3)
   04722 Neurotrophin signaling pathway
    707310 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    707310 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    707310 (PIK3R3)
   04380 Osteoclast differentiation
    707310 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    707310 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    707310 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    707310 (PIK3R3)
   05206 MicroRNAs in cancer
    707310 (PIK3R3)
   05205 Proteoglycans in cancer
    707310 (PIK3R3)
   05203 Viral carcinogenesis
    707310 (PIK3R3)
   05230 Central carbon metabolism in cancer
    707310 (PIK3R3)
   05231 Choline metabolism in cancer
    707310 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    707310 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    707310 (PIK3R3)
   05212 Pancreatic cancer
    707310 (PIK3R3)
   05225 Hepatocellular carcinoma
    707310 (PIK3R3)
   05226 Gastric cancer
    707310 (PIK3R3)
   05214 Glioma
    707310 (PIK3R3)
   05221 Acute myeloid leukemia
    707310 (PIK3R3)
   05220 Chronic myeloid leukemia
    707310 (PIK3R3)
   05218 Melanoma
    707310 (PIK3R3)
   05211 Renal cell carcinoma
    707310 (PIK3R3)
   05215 Prostate cancer
    707310 (PIK3R3)
   05213 Endometrial cancer
    707310 (PIK3R3)
   05224 Breast cancer
    707310 (PIK3R3)
   05222 Small cell lung cancer
    707310 (PIK3R3)
   05223 Non-small cell lung cancer
    707310 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    707310 (PIK3R3)
   05017 Spinocerebellar ataxia
    707310 (PIK3R3)
   05020 Prion disease
    707310 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    707310 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    707310 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    707310 (PIK3R3)
   04931 Insulin resistance
    707310 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    707310 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    707310 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    707310 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    707310 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    707310 (PIK3R3)
   05161 Hepatitis B
    707310 (PIK3R3)
   05160 Hepatitis C
    707310 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    707310 (PIK3R3)
   05164 Influenza A
    707310 (PIK3R3)
   05162 Measles
    707310 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    707310 (PIK3R3)
   05163 Human cytomegalovirus infection
    707310 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    707310 (PIK3R3)
   05169 Epstein-Barr virus infection
    707310 (PIK3R3)
   05165 Human papillomavirus infection
    707310 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    707310 (PIK3R3)
   05142 Chagas disease
    707310 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    707310 (PIK3R3)
   01524 Platinum drug resistance
    707310 (PIK3R3)
   01522 Endocrine resistance
    707310 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    707310 (PIK3R3)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    707310 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Fez1 DUF5638 PI_PP_I
Other DBs
NCBI-GeneID: 707310
NCBI-ProteinID: NP_001253755
Ensembl: ENSMMUG00000015080
UniProt: H9G113
LinkDB
Position
1
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVTNGMKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADENYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagcagttacaaatggaatgaaggacagttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaggtaaatgacaaattgcgg
gatatgccagatgggaccttcttggtccgagatgcctcaacaaaaatgcagggagattat
actttgactttgcggaagggaggcaataataagttaataaagatctatcaccgggatggt
aaatacggcttttctgatcctctgacatttaattctgtggtggagctcattaaccactat
caccatgaatctcttgctcagtacaatcccaagcttgatgtgaagctgatgtacccagtg
tccagataccaacaggatcagttggtaaaagaagataatattgatgcagtaggtaaaaaa
ctgcaagaataccactctcagtatcaagagaagagtaaagagtatgataggctctatgaa
gaatatacgagaacatcccaggaaatacagatgaagaggactgcaatagaagcttttaat
gaaacaattaaaatatttgaagagcagtgtcacacacaagaacaacatagcaaagagtat
attgagcgatttcgcagagaggggaatgaaaaggagattgaacgaattatgatgaattat
gataaattgaaatcacgtctgggagagattcatgatagcaaaatgcgtctagagcaggat
ttgaagaaacaagctttggacaaccgagaaatagataaaaaaatgaatagtatcaaacct
gacctgatccagctgcgaaagatccgagatcagcaccttgtgtggctcaatcacaaaggg
gtgagacagaaacgcctgaatgcctggctgggaattaagaatgaggatgctgatgagaac
tattttatcaatgaggaagatgaaaacctgccccactatgatgagaaaacctggtttgtt
gaggatatcaatcgagtacaagcagaggacttgctttatgggaaacctgatggtgcattc
ttaattcgtgagagtagcaagaaaggatgctatgcttgctctgtggtggctgatggggaa
gtgaagcactgtgtgatctacagcactgctcggggctatggctttgcagagccctacaac
ctgtacagctctctgaaggagctagtgctccattaccagcagacatccttggttcagcac
aacgactccctcaatgtcaggcttgcctaccctgttcatgcacagatgccctcgctgtgc
agataa

KEGG   Macaca mulatta (rhesus monkey): 709959
Entry
709959            CDS       T01028                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00562  Inositol phosphate metabolism
mcc01100  Metabolic pathways
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc01524  Platinum drug resistance
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04070  Phosphatidylinositol signaling system
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04140  Autophagy - animal
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04210  Apoptosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04218  Cellular senescence
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04380  Osteoclast differentiation
mcc04510  Focal adhesion
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04611  Platelet activation
mcc04613  Neutrophil extracellular trap formation
mcc04620  Toll-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04668  TNF signaling pathway
mcc04670  Leukocyte transendothelial migration
mcc04722  Neurotrophin signaling pathway
mcc04725  Cholinergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04810  Regulation of actin cytoskeleton
mcc04910  Insulin signaling pathway
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04917  Prolactin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04926  Relaxin signaling pathway
mcc04929  GnRH secretion
mcc04930  Type II diabetes mellitus
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc04960  Aldosterone-regulated sodium reabsorption
mcc04973  Carbohydrate digestion and absorption
mcc05010  Alzheimer disease
mcc05017  Spinocerebellar ataxia
mcc05020  Prion disease
mcc05100  Bacterial invasion of epithelial cells
mcc05132  Salmonella infection
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05146  Amoebiasis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05211  Renal cell carcinoma
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    709959 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    709959 (PIK3CA)
   04014 Ras signaling pathway
    709959 (PIK3CA)
   04015 Rap1 signaling pathway
    709959 (PIK3CA)
   04370 VEGF signaling pathway
    709959 (PIK3CA)
   04630 JAK-STAT signaling pathway
    709959 (PIK3CA)
   04668 TNF signaling pathway
    709959 (PIK3CA)
   04066 HIF-1 signaling pathway
    709959 (PIK3CA)
   04068 FoxO signaling pathway
    709959 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    709959 (PIK3CA)
   04072 Phospholipase D signaling pathway
    709959 (PIK3CA)
   04071 Sphingolipid signaling pathway
    709959 (PIK3CA)
   04024 cAMP signaling pathway
    709959 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    709959 (PIK3CA)
   04152 AMPK signaling pathway
    709959 (PIK3CA)
   04150 mTOR signaling pathway
    709959 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    709959 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    709959 (PIK3CA)
   04218 Cellular senescence
    709959 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    709959 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    709959 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    709959 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    709959 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    709959 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    709959 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    709959 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    709959 (PIK3CA)
   04660 T cell receptor signaling pathway
    709959 (PIK3CA)
   04662 B cell receptor signaling pathway
    709959 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    709959 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    709959 (PIK3CA)
   04670 Leukocyte transendothelial migration
    709959 (PIK3CA)
   04062 Chemokine signaling pathway
    709959 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    709959 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    709959 (PIK3CA)
   04929 GnRH secretion
    709959 (PIK3CA)
   04915 Estrogen signaling pathway
    709959 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    709959 (PIK3CA)
   04917 Prolactin signaling pathway
    709959 (PIK3CA)
   04926 Relaxin signaling pathway
    709959 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    709959 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    709959 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    709959 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    709959 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    709959 (PIK3CA)
   04722 Neurotrophin signaling pathway
    709959 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    709959 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    709959 (PIK3CA)
   04380 Osteoclast differentiation
    709959 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    709959 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    709959 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    709959 (PIK3CA)
   05206 MicroRNAs in cancer
    709959 (PIK3CA)
   05205 Proteoglycans in cancer
    709959 (PIK3CA)
   05203 Viral carcinogenesis
    709959 (PIK3CA)
   05230 Central carbon metabolism in cancer
    709959 (PIK3CA)
   05231 Choline metabolism in cancer
    709959 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    709959 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    709959 (PIK3CA)
   05212 Pancreatic cancer
    709959 (PIK3CA)
   05225 Hepatocellular carcinoma
    709959 (PIK3CA)
   05226 Gastric cancer
    709959 (PIK3CA)
   05214 Glioma
    709959 (PIK3CA)
   05221 Acute myeloid leukemia
    709959 (PIK3CA)
   05220 Chronic myeloid leukemia
    709959 (PIK3CA)
   05218 Melanoma
    709959 (PIK3CA)
   05211 Renal cell carcinoma
    709959 (PIK3CA)
   05215 Prostate cancer
    709959 (PIK3CA)
   05213 Endometrial cancer
    709959 (PIK3CA)
   05224 Breast cancer
    709959 (PIK3CA)
   05222 Small cell lung cancer
    709959 (PIK3CA)
   05223 Non-small cell lung cancer
    709959 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    709959 (PIK3CA)
   05017 Spinocerebellar ataxia
    709959 (PIK3CA)
   05020 Prion disease
    709959 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    709959 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    709959 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    709959 (PIK3CA)
   04931 Insulin resistance
    709959 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    709959 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    709959 (PIK3CA)
   05135 Yersinia infection
    709959 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    709959 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    709959 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    709959 (PIK3CA)
   05161 Hepatitis B
    709959 (PIK3CA)
   05160 Hepatitis C
    709959 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    709959 (PIK3CA)
   05164 Influenza A
    709959 (PIK3CA)
   05162 Measles
    709959 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    709959 (PIK3CA)
   05163 Human cytomegalovirus infection
    709959 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    709959 (PIK3CA)
   05169 Epstein-Barr virus infection
    709959 (PIK3CA)
   05165 Human papillomavirus infection
    709959 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    709959 (PIK3CA)
   05142 Chagas disease
    709959 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    709959 (PIK3CA)
   01524 Platinum drug resistance
    709959 (PIK3CA)
   01522 Endocrine resistance
    709959 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    709959 (PIK3CA)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     709959 (PIK3CA)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    709959 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 709959
NCBI-ProteinID: NP_001247597
Ensembl: ENSMMUG00000005188
UniProt: H9FVU5
LinkDB
Position
2
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccacgaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgactttagaatgcctccgtgaggct
acattaataaccataaagcatgaactatttaaagaagcaagaaaataccccctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
attggcatgccagtgtgtgaatttgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttagggatctcaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcgccagaattgccaaagcac
atatataataaattagataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtaccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcctctgaacagctaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgttgatggctaaagaaagcctttattctcaactgccaatggac
tgttttacaatgccatcttattccagacgcatttccacagctacaccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaattctttgt
gcaacctacgtgaatgtaaatattcgagacattgataagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgacaatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctgaattatgatatatacattcctgaccttcctcgtgctgct
cgactttgcctttccatttgctctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcatggggaaatataaacttgtttgattacacagacactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggattagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgcttagagttggagtttgactggttc
agcagtgtggtaaagttcccagatatgtcagtgattgaagagcatgccaattggtctgtg
tcccgagaagcaggatttagctattcccacgcaggactgagtaacaggctagctagagac
aatgaattaagggaaaatgacaaagaacagctcaaagcaatttctacacgagatcctctc
tctgaaatcactgagcaggagaaagattttctgtggagccacagacactattgtgtaact
atccccgaaattctacccaaattgcttctgtctgttaaatggaattctagagatgaagta
gcccagatgtattgcttggtaaaagactggcctccaatcaaacctgaacaggctatggaa
cttctggactgtaattacccagatcctatggttcgaggttttgctgttcggtgcttggaa
aaatatttaacagatgacaaactttctcagtatttaattcagctagtacaggtcctaaaa
tatgaacaatatttggataacttgcttgtgagatttttactgaagaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agccagaggtttggcctgcttttggagtcctattgtcgtgcatgtgggatgtatttgaag
cacctgaataggcaagtcgaggcaatggaaaagctcattaacttaactgacattctcaaa
caggagaaaaaggatgaaacacaaaaggtacagatgaagtttttagttgagcaaatgagg
cgaccagatttcatggatgctctgcagggctttctatctcctctaaaccctgctcatcaa
ctaggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactgtttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcaaattattcgtattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtca
atcggtgactgtgtgggacttattgaggtggtgcgaaattctcacactattatgcaaatt
cagtgcaaaggcggcttgaaaggtgcactgcagttcaacagccacactctacatcagtgg
ctcaaagacaagaacaaaggagaaatatatgatgcagccattgacctgtttacacgttca
tgtgctggatattgtgtcgctaccttcattctgggaattggagatcgtcacaatagtaac
atcatggtgaaagacgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggctataaacgagaacgtgtgccatttgttttgacacaggatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcgacagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgacattgca
tacattcgaaagaccctagccttagataaaactgagcaagaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaaacagcatgcattgaactga

KEGG   Macaca mulatta (rhesus monkey): 710552
Entry
710552            CDS       T01028                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00562  Inositol phosphate metabolism
mcc01100  Metabolic pathways
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc01524  Platinum drug resistance
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04070  Phosphatidylinositol signaling system
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04140  Autophagy - animal
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04210  Apoptosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04218  Cellular senescence
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04380  Osteoclast differentiation
mcc04510  Focal adhesion
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04611  Platelet activation
mcc04613  Neutrophil extracellular trap formation
mcc04620  Toll-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04668  TNF signaling pathway
mcc04670  Leukocyte transendothelial migration
mcc04722  Neurotrophin signaling pathway
mcc04725  Cholinergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04810  Regulation of actin cytoskeleton
mcc04910  Insulin signaling pathway
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04917  Prolactin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04926  Relaxin signaling pathway
mcc04929  GnRH secretion
mcc04930  Type II diabetes mellitus
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc04960  Aldosterone-regulated sodium reabsorption
mcc04973  Carbohydrate digestion and absorption
mcc05010  Alzheimer disease
mcc05017  Spinocerebellar ataxia
mcc05020  Prion disease
mcc05100  Bacterial invasion of epithelial cells
mcc05132  Salmonella infection
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05146  Amoebiasis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05211  Renal cell carcinoma
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    710552 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    710552 (PIK3CD)
   04014 Ras signaling pathway
    710552 (PIK3CD)
   04015 Rap1 signaling pathway
    710552 (PIK3CD)
   04370 VEGF signaling pathway
    710552 (PIK3CD)
   04630 JAK-STAT signaling pathway
    710552 (PIK3CD)
   04668 TNF signaling pathway
    710552 (PIK3CD)
   04066 HIF-1 signaling pathway
    710552 (PIK3CD)
   04068 FoxO signaling pathway
    710552 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    710552 (PIK3CD)
   04072 Phospholipase D signaling pathway
    710552 (PIK3CD)
   04071 Sphingolipid signaling pathway
    710552 (PIK3CD)
   04024 cAMP signaling pathway
    710552 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    710552 (PIK3CD)
   04152 AMPK signaling pathway
    710552 (PIK3CD)
   04150 mTOR signaling pathway
    710552 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    710552 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    710552 (PIK3CD)
   04218 Cellular senescence
    710552 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    710552 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    710552 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    710552 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    710552 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    710552 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    710552 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    710552 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    710552 (PIK3CD)
   04660 T cell receptor signaling pathway
    710552 (PIK3CD)
   04662 B cell receptor signaling pathway
    710552 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    710552 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    710552 (PIK3CD)
   04670 Leukocyte transendothelial migration
    710552 (PIK3CD)
   04062 Chemokine signaling pathway
    710552 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    710552 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    710552 (PIK3CD)
   04929 GnRH secretion
    710552 (PIK3CD)
   04915 Estrogen signaling pathway
    710552 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    710552 (PIK3CD)
   04917 Prolactin signaling pathway
    710552 (PIK3CD)
   04926 Relaxin signaling pathway
    710552 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    710552 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    710552 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    710552 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    710552 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    710552 (PIK3CD)
   04722 Neurotrophin signaling pathway
    710552 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    710552 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    710552 (PIK3CD)
   04380 Osteoclast differentiation
    710552 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    710552 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    710552 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710552 (PIK3CD)
   05206 MicroRNAs in cancer
    710552 (PIK3CD)
   05205 Proteoglycans in cancer
    710552 (PIK3CD)
   05203 Viral carcinogenesis
    710552 (PIK3CD)
   05230 Central carbon metabolism in cancer
    710552 (PIK3CD)
   05231 Choline metabolism in cancer
    710552 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    710552 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    710552 (PIK3CD)
   05212 Pancreatic cancer
    710552 (PIK3CD)
   05225 Hepatocellular carcinoma
    710552 (PIK3CD)
   05226 Gastric cancer
    710552 (PIK3CD)
   05214 Glioma
    710552 (PIK3CD)
   05221 Acute myeloid leukemia
    710552 (PIK3CD)
   05220 Chronic myeloid leukemia
    710552 (PIK3CD)
   05218 Melanoma
    710552 (PIK3CD)
   05211 Renal cell carcinoma
    710552 (PIK3CD)
   05215 Prostate cancer
    710552 (PIK3CD)
   05213 Endometrial cancer
    710552 (PIK3CD)
   05224 Breast cancer
    710552 (PIK3CD)
   05222 Small cell lung cancer
    710552 (PIK3CD)
   05223 Non-small cell lung cancer
    710552 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    710552 (PIK3CD)
   05017 Spinocerebellar ataxia
    710552 (PIK3CD)
   05020 Prion disease
    710552 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    710552 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    710552 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    710552 (PIK3CD)
   04931 Insulin resistance
    710552 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    710552 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    710552 (PIK3CD)
   05135 Yersinia infection
    710552 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    710552 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    710552 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    710552 (PIK3CD)
   05161 Hepatitis B
    710552 (PIK3CD)
   05160 Hepatitis C
    710552 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    710552 (PIK3CD)
   05164 Influenza A
    710552 (PIK3CD)
   05162 Measles
    710552 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    710552 (PIK3CD)
   05163 Human cytomegalovirus infection
    710552 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    710552 (PIK3CD)
   05169 Epstein-Barr virus infection
    710552 (PIK3CD)
   05165 Human papillomavirus infection
    710552 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    710552 (PIK3CD)
   05142 Chagas disease
    710552 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    710552 (PIK3CD)
   01524 Platinum drug resistance
    710552 (PIK3CD)
   01522 Endocrine resistance
    710552 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    710552 (PIK3CD)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     710552 (PIK3CD)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    710552 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2
Other DBs
NCBI-GeneID: 710552
NCBI-ProteinID: XP_015003339
Ensembl: ENSMMUG00000006224
UniProt: H9ZA48
LinkDB
Position
1
AA seq 1044 aa
MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFH
MLSGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLCDPEVNDFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARTWGP
GTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
AKPPPIPAKKPFSVSLWSLEQPFCIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVSVCSEPVWKQRLEFDIHICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAP
HPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQE
HFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMR
QEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSGGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccctggggtggactgccccatggaattctggaccaaggaggagaatcagagcgtc
gtggttgacttcctgctgcccacaggggtctacctgaacttccctgtgtcccgcaatgcc
aacctcagcaccatcaagcagctgctgtggcaccgcgcccagtatgagccactcttccac
atgctcagtggccccgaggcctatgtgttcacctgcatcaaccagacggcggagcagcag
gagctggaggatgagcaacggcgtctgtgcgacgtgcagcccttcctgcccgtcctgcgc
ctggtggcccgcgagggcgaccgcgtgaagaagctcatcaactcgcagatcagcctcctc
atcggcaaaggcctccacgagtttgactccttgtgcgacccagaagtgaacgactttcgt
gccaagatgtgccagttctgcgaggaggcggccgcccgccggcagcagctgggctgggag
gcctggttgcagtacagcttccccctgcagctggagccctcggctcgaacctggggccct
ggcaccctgcggctcccaaaccgggccctcctggtcaacgtcaagtttgagggcagcgag
gagagcttcaccttccaggtgtccaccaaggacgtgccgctggcgctgatggcctgtgcc
ctgcggaagaaggccacggtgttccggcagccgctggtggagcagccggaagactacacg
ctgcaggtgaacggcaggcatgagtacctgtacggcagctacccgctctgccagttccag
tacatctgcagctgcctgcacagtgggctgacccctcacctgaccatggtccattcctcc
tccatcctcgccatgcgggatgagcagagcaaccctgccccccaggtccagaaaccacgt
gccaagccgcctcccattcctgcaaagaagcccttctctgtgtccctgtggtccctggag
cagccgttctgcatcgagctcatccagggcagcaaagtgaacgccgacgagcggatgaag
ctggtggtgcaggcagggcttttccacggcaacgagatgctgtgcaagacggtgtccagc
tcggaggtgagcgtgtgctcggaacctgtgtggaagcagcggctagagttcgacatccac
atctgcgacctgccccgcatggcccgtctctgctttgcactgtacgccgtgatcgagaaa
gccaagaaggcccgctccaccaagaagaagtccaagaaggcggactgccccattgcctgg
gccaacctcatgctgtttgactacaaggaccagcttaagactggggaacgctgtctctac
atgtggccctccgtcccagatgagaagggcgagctgctgaaccccacaggcactgtgcgt
agtaaccccaacacggatagcgccgccgccctgctcatctgcctgcctgaggtggccccg
caccccgtgtactatcccgccctggagaagatcttggagctggggcggcacagtgagtgt
gtacatgtcactgaggaggagcagctgcagctgcgggaaatcctggagcggcgggggtct
ggggagctgtatgagcatgagaaggacctggtgtggaagctgcggcacgaagtccaggag
cacttcccggaggcgctagcccggctgctgctggtcaccaagtggaacaagcacgaggat
gtggcccagatgctctacctgctgtgctcctggccggagctgcctgtcctgagcgccctg
gagctgctggacttcagcttccctgattgccacgtaggctcctttgccatcaagtcgctg
cggaaactgacggacgatgagctgttccagtacttgctgcagctggtgcaggtgctaaag
tatgagtcctacctggactgcgagctgaccaaattcctgctggaccgggccctggccaac
cgcaagatcggccacttccttttctggcacctccgctccgagatgcacgtgccgtcggtg
gccctgcgcttcggcctcatcttggaggcctactgcaggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagcactgagcaaactgaaggcactgaacgacttcgtcaag
ctgagctctcagaagacccccaagccccagacgaaggagctgatgcacttgtgcatgcgg
caggaggcctacctagaggccctctcccacctgcagtccccactcgaccccagcaccctg
ctggctgaagtctgtgtggagcagtgcaccttcatggactccaagatgaagcccctgtgg
atcatgtacagcaacgaggaggcaggcagcggcggcagcgtgggcatcatctttaagaac
ggggatgacctccggcaggacatgctgaccctgcagatgatccagctcatggacgtcctg
tggaagcaggaggggctggacctgaggatgaccccctacggctgcctccccaccggggac
cgcacaggcctcattgaggtggtactccgctcagacaccattgccaacatccaactcaac
aagagcaacatggcagccacagccgccttcaacaaggatgccctgctcaactggctgaag
tccaagaacccaggggaggccctggatcgagccattgaggagttcaccctctcctgtgct
ggctactgtgtggccacatacgtgctgggcatcggcgatcggcacagcgacaacatcatg
atccgagagagtgggcagctgttccacattgattttggccactttctggggaatttcaag
accaagtttggaatcaaccgtgagcgtgtcccattcatcctcacctatgactttgtccat
gtgattcagcaggggaagactaataacagtgagaaatttgaaaggttccggggctactgt
gaaagggcctacaccatcctgcggcgccacgggcttctcttcctccacctctttgccctg
atgcgggcggcaggcctgcctgagctcagctgctccaaagacatccagtacctcaaggac
tccctggcactggggaaaacagaggaggaggcgctgaagcacttccgagtgaagtttaat
gaagccctccgtgagagctggaaaaccaaagtgaactggctggcccacaacgtgtccaag
gacaacaggcagtag

KEGG   Macaca mulatta (rhesus monkey): 716098
Entry
716098            CDS       T01028                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00562  Inositol phosphate metabolism
mcc01100  Metabolic pathways
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc01524  Platinum drug resistance
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04070  Phosphatidylinositol signaling system
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04140  Autophagy - animal
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04210  Apoptosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04218  Cellular senescence
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04380  Osteoclast differentiation
mcc04510  Focal adhesion
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04611  Platelet activation
mcc04613  Neutrophil extracellular trap formation
mcc04620  Toll-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04668  TNF signaling pathway
mcc04670  Leukocyte transendothelial migration
mcc04722  Neurotrophin signaling pathway
mcc04725  Cholinergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04810  Regulation of actin cytoskeleton
mcc04910  Insulin signaling pathway
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04917  Prolactin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04926  Relaxin signaling pathway
mcc04929  GnRH secretion
mcc04930  Type II diabetes mellitus
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc04960  Aldosterone-regulated sodium reabsorption
mcc04973  Carbohydrate digestion and absorption
mcc05010  Alzheimer disease
mcc05017  Spinocerebellar ataxia
mcc05020  Prion disease
mcc05100  Bacterial invasion of epithelial cells
mcc05132  Salmonella infection
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05146  Amoebiasis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05211  Renal cell carcinoma
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    716098 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    716098 (PIK3CB)
   04014 Ras signaling pathway
    716098 (PIK3CB)
   04015 Rap1 signaling pathway
    716098 (PIK3CB)
   04370 VEGF signaling pathway
    716098 (PIK3CB)
   04630 JAK-STAT signaling pathway
    716098 (PIK3CB)
   04668 TNF signaling pathway
    716098 (PIK3CB)
   04066 HIF-1 signaling pathway
    716098 (PIK3CB)
   04068 FoxO signaling pathway
    716098 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    716098 (PIK3CB)
   04072 Phospholipase D signaling pathway
    716098 (PIK3CB)
   04071 Sphingolipid signaling pathway
    716098 (PIK3CB)
   04024 cAMP signaling pathway
    716098 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    716098 (PIK3CB)
   04152 AMPK signaling pathway
    716098 (PIK3CB)
   04150 mTOR signaling pathway
    716098 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    716098 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    716098 (PIK3CB)
   04218 Cellular senescence
    716098 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    716098 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    716098 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    716098 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    716098 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    716098 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    716098 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    716098 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    716098 (PIK3CB)
   04660 T cell receptor signaling pathway
    716098 (PIK3CB)
   04662 B cell receptor signaling pathway
    716098 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    716098 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    716098 (PIK3CB)
   04670 Leukocyte transendothelial migration
    716098 (PIK3CB)
   04062 Chemokine signaling pathway
    716098 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    716098 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    716098 (PIK3CB)
   04929 GnRH secretion
    716098 (PIK3CB)
   04915 Estrogen signaling pathway
    716098 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    716098 (PIK3CB)
   04917 Prolactin signaling pathway
    716098 (PIK3CB)
   04926 Relaxin signaling pathway
    716098 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    716098 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    716098 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    716098 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    716098 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    716098 (PIK3CB)
   04722 Neurotrophin signaling pathway
    716098 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    716098 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    716098 (PIK3CB)
   04380 Osteoclast differentiation
    716098 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    716098 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    716098 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    716098 (PIK3CB)
   05206 MicroRNAs in cancer
    716098 (PIK3CB)
   05205 Proteoglycans in cancer
    716098 (PIK3CB)
   05203 Viral carcinogenesis
    716098 (PIK3CB)
   05230 Central carbon metabolism in cancer
    716098 (PIK3CB)
   05231 Choline metabolism in cancer
    716098 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    716098 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    716098 (PIK3CB)
   05212 Pancreatic cancer
    716098 (PIK3CB)
   05225 Hepatocellular carcinoma
    716098 (PIK3CB)
   05226 Gastric cancer
    716098 (PIK3CB)
   05214 Glioma
    716098 (PIK3CB)
   05221 Acute myeloid leukemia
    716098 (PIK3CB)
   05220 Chronic myeloid leukemia
    716098 (PIK3CB)
   05218 Melanoma
    716098 (PIK3CB)
   05211 Renal cell carcinoma
    716098 (PIK3CB)
   05215 Prostate cancer
    716098 (PIK3CB)
   05213 Endometrial cancer
    716098 (PIK3CB)
   05224 Breast cancer
    716098 (PIK3CB)
   05222 Small cell lung cancer
    716098 (PIK3CB)
   05223 Non-small cell lung cancer
    716098 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    716098 (PIK3CB)
   05017 Spinocerebellar ataxia
    716098 (PIK3CB)
   05020 Prion disease
    716098 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    716098 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    716098 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    716098 (PIK3CB)
   04931 Insulin resistance
    716098 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    716098 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    716098 (PIK3CB)
   05135 Yersinia infection
    716098 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    716098 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    716098 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    716098 (PIK3CB)
   05161 Hepatitis B
    716098 (PIK3CB)
   05160 Hepatitis C
    716098 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    716098 (PIK3CB)
   05164 Influenza A
    716098 (PIK3CB)
   05162 Measles
    716098 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    716098 (PIK3CB)
   05163 Human cytomegalovirus infection
    716098 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    716098 (PIK3CB)
   05169 Epstein-Barr virus infection
    716098 (PIK3CB)
   05165 Human papillomavirus infection
    716098 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    716098 (PIK3CB)
   05142 Chagas disease
    716098 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    716098 (PIK3CB)
   01524 Platinum drug resistance
    716098 (PIK3CB)
   01522 Endocrine resistance
    716098 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    716098 (PIK3CB)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     716098 (PIK3CB)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    716098 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C
Other DBs
NCBI-GeneID: 716098
NCBI-ProteinID: XP_014987568
Ensembl: ENSMMUG00000008666
UniProt: F7F3S0 A0A663DHT5
LinkDB
Position
2
AA seq 1070 aa
MCFSFIMPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDSLKDPEVNEFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEH
EPSIPENLEDKLYGGKLIVAIHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEVSGKNDHIWNEPLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKE
ILDRDPLSQLCENEMDLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALGNRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAVKLNRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttcagtttcataatgcctcctgctatggcagacatccttgacatctgggcggtg
gattcacagatagcatctgatggctccatacctgtggatttccttttgcccactgggatt
tatatccagttggaggtacctcgggaagctaccatttcttatattaagcagatgttatgg
aagcaagttcacaattacccaatgttcaacctccttatggatattgactcctatatgttt
gcatgtgtgaaccagactgctgtatatgaggagcttgaagatgaaacacgaagactctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaaaaggtctgcatgaatttgattccttg
aaggatcctgaagtaaatgaatttcgaagaaaaatgcgcaaattcagcgaggaaaagatc
ctgtcacttgtgggattgtcttggatggactggctaaaacaaacatatccaccggagcat
gaaccatccatccctgaaaacttagaagataaactttatgggggaaagctcattgtagct
attcattttgaaaactgccaggatgtgtttagctttcaagtatctcctaatatgaatcct
atcaaagtaaatgaattggcaatccaaaaacgtttgactattcatgggaaggaagatgaa
gttagcccctatgattatgtgttgcaagtcagtgggagagtagaatatgtttttggtgat
catccactaattcagttccagtatatccggaactgtgtaatgaacaggaccctgccccat
tttatacttgtggaatgctgcaagatcaagaaaatgtatgaacaggaaatgattgccata
gaggctgccataaatcggaattcatctaaccttcctcttccattaccaccaaagaaaacg
cgaattatttctcatgtttgggaaaataataaccctttccaaattgtcttggttaaggga
aataaacttaacacagaggaaactgtaaaagttcatgtcagggctggtctttttcatggt
actgaactcctgtgtaaaaccatcgtaagctcagaggtatcagggaaaaatgatcatatt
tggaatgaaccactggaatttgatattaatatttgtgacttaccaagaatggctcgatta
tgttttgctgtttatgctgttttggataaagtaaaaacgaagaaatcaacgaaaactatt
aatccctctaaatatcagaccatcagaaaagctggaaaagtgcattatcctgtagcgtgg
gtaaatacgatggtttttgactttaaaggacaattgagaactggagacataatattacac
agctggtcttcatttcctgatgaactcgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatactgaaaatgcaacagctttgcatattaaatttccagagaataaaaaa
caaccttattattaccctcccttcgataagattattgaaaaggctgctgagattgcaagc
agtgatagtgctaatgtgtcaagtcgaggtggaaaaaagtttcttcctgtattgaaagaa
atcttggacagggatcccttgtctcaactgtgtgaaaatgaaatggatcttatttggact
ttgcgacaagactgccgagagattttcccacaatcattgccaaaattactgctgtcaatc
aagtggaataaacttgaggatgttgctcagcttcaggcgctgcttcagatttggcctaaa
ctgcccccccgggaggccctagagcttctggatttcaactatccagaccagtacgttcga
gaatatgctgtaggctgcctgcgacagatgagtgatgaagaactttcgcagtatctttta
caactggtgcaagttttaaaatatgagccttttcttgattgtgccctctctagattccta
ttagaaagagcacttggtaatcggaggatagggcagtttctattttggcatcttaggtca
gaagtgcacattcctgctgtctcagtacaatttggtgtcatccttgaagcatactgccgg
ggaagtgtggggcacatgaaagtgctttctaagcaggttgaagcactcaataagttaaaa
actttaaatagtttaatcaaactgaatgcagtgaagttaaacagagccaaagggaaggag
gccatgcatacttgtttaaaacagagtgcttaccgggaagccctctctgacctgcagtcg
cccctgaacccatgtgttatcctctcggaactctatgttgaaaagtgcaaatacatggat
tccaaaatgaagcctttgtggctggtatacaataacaaggtatttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacgacaggatatgttgacactccagatgttg
cgcttgatggatttactctggaaagaagctggtttggatcttcggatgttgccttatggc
tgtttagcaacaggagatcgctctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgctgcagcagccttcaacaaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctggaccgagccattgaggaa
tttacactgtcctgtgctggctactgtgtagcttcttatgtccttgggattggtgacaga
catagtgacaacatcatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaaatctaagtttggcattaaaagggagcgagtgccttttattctt
acctatgatttcatccatgtcattcaacaaggaaaaacaggaaatacagaaaagtttggc
cggttccgccagtgttgtgaggatgcatatctgattttacgacggcatgggaatcttttc
atcactctctttgcgctgatgttgactgcagggcttcctgagctcacatcagtcaaggat
atacagtatcttaaggactctcttgcattagggaagagtgaagaagaagcactcaaacag
tttaagcaaaaatttgatgaggcgctcagggaaagctggactactaaagtgaactggatg
gcccacacagttcggaaagactacagatcttaa

KEGG   Macaca mulatta (rhesus monkey): 719367
Entry
719367            CDS       T01028                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc01524  Platinum drug resistance
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04070  Phosphatidylinositol signaling system
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04140  Autophagy - animal
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04210  Apoptosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04218  Cellular senescence
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04380  Osteoclast differentiation
mcc04510  Focal adhesion
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04611  Platelet activation
mcc04613  Neutrophil extracellular trap formation
mcc04620  Toll-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04668  TNF signaling pathway
mcc04670  Leukocyte transendothelial migration
mcc04722  Neurotrophin signaling pathway
mcc04725  Cholinergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04810  Regulation of actin cytoskeleton
mcc04910  Insulin signaling pathway
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04917  Prolactin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04926  Relaxin signaling pathway
mcc04929  GnRH secretion
mcc04930  Type II diabetes mellitus
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc04960  Aldosterone-regulated sodium reabsorption
mcc04973  Carbohydrate digestion and absorption
mcc05010  Alzheimer disease
mcc05017  Spinocerebellar ataxia
mcc05020  Prion disease
mcc05100  Bacterial invasion of epithelial cells
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05146  Amoebiasis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05211  Renal cell carcinoma
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    719367 (PIK3R2)
   04014 Ras signaling pathway
    719367 (PIK3R2)
   04015 Rap1 signaling pathway
    719367 (PIK3R2)
   04370 VEGF signaling pathway
    719367 (PIK3R2)
   04630 JAK-STAT signaling pathway
    719367 (PIK3R2)
   04668 TNF signaling pathway
    719367 (PIK3R2)
   04066 HIF-1 signaling pathway
    719367 (PIK3R2)
   04068 FoxO signaling pathway
    719367 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    719367 (PIK3R2)
   04072 Phospholipase D signaling pathway
    719367 (PIK3R2)
   04071 Sphingolipid signaling pathway
    719367 (PIK3R2)
   04024 cAMP signaling pathway
    719367 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    719367 (PIK3R2)
   04152 AMPK signaling pathway
    719367 (PIK3R2)
   04150 mTOR signaling pathway
    719367 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    719367 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    719367 (PIK3R2)
   04218 Cellular senescence
    719367 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    719367 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    719367 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    719367 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    719367 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    719367 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    719367 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    719367 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    719367 (PIK3R2)
   04660 T cell receptor signaling pathway
    719367 (PIK3R2)
   04662 B cell receptor signaling pathway
    719367 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    719367 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    719367 (PIK3R2)
   04670 Leukocyte transendothelial migration
    719367 (PIK3R2)
   04062 Chemokine signaling pathway
    719367 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    719367 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    719367 (PIK3R2)
   04929 GnRH secretion
    719367 (PIK3R2)
   04915 Estrogen signaling pathway
    719367 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    719367 (PIK3R2)
   04917 Prolactin signaling pathway
    719367 (PIK3R2)
   04926 Relaxin signaling pathway
    719367 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    719367 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    719367 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    719367 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    719367 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    719367 (PIK3R2)
   04722 Neurotrophin signaling pathway
    719367 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    719367 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    719367 (PIK3R2)
   04380 Osteoclast differentiation
    719367 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    719367 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    719367 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    719367 (PIK3R2)
   05206 MicroRNAs in cancer
    719367 (PIK3R2)
   05205 Proteoglycans in cancer
    719367 (PIK3R2)
   05203 Viral carcinogenesis
    719367 (PIK3R2)
   05230 Central carbon metabolism in cancer
    719367 (PIK3R2)
   05231 Choline metabolism in cancer
    719367 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    719367 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    719367 (PIK3R2)
   05212 Pancreatic cancer
    719367 (PIK3R2)
   05225 Hepatocellular carcinoma
    719367 (PIK3R2)
   05226 Gastric cancer
    719367 (PIK3R2)
   05214 Glioma
    719367 (PIK3R2)
   05221 Acute myeloid leukemia
    719367 (PIK3R2)
   05220 Chronic myeloid leukemia
    719367 (PIK3R2)
   05218 Melanoma
    719367 (PIK3R2)
   05211 Renal cell carcinoma
    719367 (PIK3R2)
   05215 Prostate cancer
    719367 (PIK3R2)
   05213 Endometrial cancer
    719367 (PIK3R2)
   05224 Breast cancer
    719367 (PIK3R2)
   05222 Small cell lung cancer
    719367 (PIK3R2)
   05223 Non-small cell lung cancer
    719367 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    719367 (PIK3R2)
   05017 Spinocerebellar ataxia
    719367 (PIK3R2)
   05020 Prion disease
    719367 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    719367 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    719367 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    719367 (PIK3R2)
   04931 Insulin resistance
    719367 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    719367 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    719367 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    719367 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    719367 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    719367 (PIK3R2)
   05161 Hepatitis B
    719367 (PIK3R2)
   05160 Hepatitis C
    719367 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    719367 (PIK3R2)
   05164 Influenza A
    719367 (PIK3R2)
   05162 Measles
    719367 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    719367 (PIK3R2)
   05163 Human cytomegalovirus infection
    719367 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    719367 (PIK3R2)
   05169 Epstein-Barr virus infection
    719367 (PIK3R2)
   05165 Human papillomavirus infection
    719367 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    719367 (PIK3R2)
   05142 Chagas disease
    719367 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    719367 (PIK3R2)
   01524 Platinum drug resistance
    719367 (PIK3R2)
   01522 Endocrine resistance
    719367 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    719367 (PIK3R2)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    719367 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 Ribosomal_L22e Tai4 ATG11
Other DBs
NCBI-GeneID: 719367
NCBI-ProteinID: NP_001244981
Ensembl: ENSMMUG00000003162
UniProt: F7EP57
LinkDB
Position
19
AA seq 727 aa
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQNVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGAPEPGLTLPDLPEQFSP
PDVAPPLLVKLVEAIERTGLDSESHYRPELPTPRTDWTLSDVDQWDVTALADGIKSFLLA
LPAPLVTPEASAEARRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLGRVARRAPALG
PAVRALGATFGPLLLRAPPPSSPPPGGAPDGSEPSPDFPALLVEKLLQEHLEEQEVAPPA
LPPKPPKAKLAPAGLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKI
QGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLINHYRHESLAQYNAKLDTRL
LYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAI
EAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTK
LEQQLRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNET
EDQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVV
DGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGP
GPPPAAR
NT seq 2184 nt   +upstreamnt  +downstreamnt
atggcgggccctgagggtttccagtaccgcgctctgtacccgttccgccgggagcggcca
gaggacctggagctgctgcctggcgatgtgctggtagtgagccgggcggccttgcaggca
ctgggtgtggccgagggtggcgagcgctgcccacagaatgtgggctggatgcccggcctc
aacgagcgcacacggcagcgaggtgacttccctggcacctacgtcgagttcctggggccc
gtggccctggcccggcctggccctcgcccacggggcccccgcccactgcccgccaggccc
cgtgatggggcccctgagccaggcctcacactccccgacttgcctgagcagttctcccca
cccgatgtggcaccccctcttctggtgaagcttgtggaggccattgaaaggacagggctg
gacagcgaatctcactaccggccggagctgcccacaccgcgtacagactggaccctgagc
gacgtggaccagtgggacgtgaccgccttggctgacggcattaagagcttccttctggca
ctgcccgcaccgctcgtgacccccgaggcctcggctgaggcgcgcagggccctgcgggag
gccgcggggcctgtggggccggcactggagccaccgacgctgccgctgcaccgcgcgctc
acgctgcgcttcctgctccagcacctgggccgcgtggcccgccgcgccccggccctgggt
cccgcggtccgggccctgggcgccacctttgggccgctgctgctgcgcgcgccgccgccg
tcctcgccgccgccagggggcgctcccgacgggagtgagcccagtcctgacttcccggca
ctgctggtggagaagctgcttcaggaacacttggaagagcaggaggttgcgcccccagcg
ctgccgcctaaaccccccaaggcaaagctggcccctgcaggcctggcgaatggagggagt
ccaccctccctgcaggatgccgagtggtactggggggacatttcaagggaggaggtgaac
gagaaactccgagacactcccgatggcaccttcctagtccgagatgcttccagcaagatc
cagggcgagtacacgctgaccctcaggaaaggcgggaacaataaactgatcaaggtcttc
caccgagatgggcactacggcttctcagagccactcaccttctgctccgtcgtggacctc
atcaatcactaccgccacgagtcgctggcccaatacaacgccaagctggacacacggctc
ctctaccctgtgtccaaataccagcaggaccagatcgtcaaggaggacagcgtggaggcg
gtgggcgcccagctcaaggtctatcaccagcagtaccaggacaagagccgcgagtatgac
cagctctatgaagagtacacacggacctcccaggagctgcagatgaagcgtaccgcgatt
gaggccttcaatgagactatcaagatctttgaagagcagggccagactcaagagaagtgc
agcaaggaatacctggagcgcttccggcgtgagggcaacgagaaagagatgcagaggatc
ctgcttaactctgagcggctcaagtcccgcattgccgagatccacgagagccgcacgaag
ctggagcagcagctgcgggcccaggcctcggacaaccgggagatcgacaagcgcatgaac
agcctcaagccagacctcatgcagctgcgtaagatccgagaccagtacctcgtgtggctc
acccagaaaggcgcccggcagaagaaaatcaacgagtggctggggatcaaaaatgagact
gaggaccagtacgcgctgatggaggacgaggacgatctcccgcaccacgaggaacgcact
tggtacgtgggcaagatcaaccgcacgcaggcagaggagatgctgagtggcaagcgggat
ggcaccttcctcatccgcgagagcagccagcggggctgctacgcctgctccgtggtggtg
gacggagacaccaagcactgcgtcatctaccgcacggccaccggcttcggcttcgcggag
ccctacaacctgtacgggtcgctgaaggagctggtgctgcactaccagcacgcctcgctc
gtgcagcacaacgacgcgctcaccgtcaccctggcgcacccagtacgcgccccgggcccc
ggcccgccgcctgccgcccgctga

DBGET integrated database retrieval system