KEGG   Macaca mulatta (rhesus monkey): 699042
Entry
699042            CDS       T01028                                 

Gene name
WASF1
Definition
(RefSeq) wiskott-Aldrich syndrome protein family member 1 isoform X1
  KO
K05753  WAS protein family, member 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04520  Adherens junction
mcc04666  Fc gamma R-mediated phagocytosis
mcc04810  Regulation of actin cytoskeleton
mcc05100  Bacterial invasion of epithelial cells
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    699042 (WASF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    699042 (WASF1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    699042 (WASF1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    699042 (WASF1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    699042 (WASF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    699042 (WASF1)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     699042 (WASF1)
SSDB
Motif
Pfam: WH2
Other DBs
NCBI-GeneID: 699042
NCBI-ProteinID: XP_014993073
Ensembl: ENSMMUG00000014764
UniProt: G7MQW9 A0A5F7ZCJ6
LinkDB
Position
4
AA seq 559 aa
MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAH
SFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIP
LQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQK
QKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQ
TYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPIPTCISSA
TGLIENRPQSPATGRTPVFVSPTPPPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPPT
TALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEV
QGLPPPPPPPPLPPPGIRPSSPVTVTALAHPPSGLHPTPSTAPGPHVPLMPPSPPSQVIP
ASEPKRHPSTLPVISDARSVLLEAIRKGIQLRKVEEQREQEAKHERIENDVATILSRRIA
VEYSDSEDDSEFDEVDWLE
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgccactagtgaaaagaaacatcgatcctaggcacttgtgccacacagcactgcctaga
ggcattaagaatgaactggaatgtgtaaccaatatttccttggcaaatataattagacaa
ctaagtagcctaagtaaatatgctgaagatatatttggagaattattcaatgaagcacat
agtttttccttcagagtcaactcattgcaagaacgtgtggaccgtttatccgttagtgtt
acacagcttgatccaaaggaagaagaattgtctttgcaagatataacaatgaggaaagct
ttccgaagttctacaattcaagaccagcagctttttgatcgcaagactttgcctattcca
ttacaggagacgtacgatgtttgtgaacagcctccacctctcaatatactcactccttat
agagatgatggtaaagaaggtctgaagttttataccaatccttcatatttctttgatcta
tggaaagaaaaaatgttgcaagatacagaggataagaggaaggaaaagaggaagcagaag
cagaaaaatctagatcgtcctcatgaaccagaaaaagtgccaagagcacctcatgacagg
cggcgagaatggcagaagctggcccaaggtccagagctggctgaagatgatgctaatctc
ttacataagcatattgaagttgctaatggtccagcctctcattttgaaacaagacctcag
acatacgtggatcatatggatggatcgtactcactttctgccttgccatttagtcagatg
agtgagcttctgactagagctgaggaaagggtattagtcagaccacatgaaccacctccg
cctccaccaatgcatggagcaggagatgcgaaaccgatacccacctgtatcagttctgct
acaggtttgatagaaaatcgccctcagtcaccggctacaggcagaacacctgtgtttgtg
agccccactcccccacctcctccaccacctcttccatctgccttgtcaacttcctcatta
agagcttcaatgacttcaactcctccccctccagtgcctcccccacctccacctccaacc
actgctttgcaagctccagcagtaccaccacctccagctcctcttcagattgcccctgga
gttcttcacccagctcctcctccaattgcacctcctctagtacagccctctccaccagta
gctagagctgccccagtatgtgaaactgtaccagttcatccactcccacaaggtgaagtt
caggggctgcctccacccccaccaccgcctcctctgcctccacctggcattcgaccatca
tcacctgtcacagttacagctcttgctcatcctccctctgggctacatccaactccatct
actgccccaggtccccatgttccattaatgcctccatctcctccatcacaagttatacct
gcttctgagccaaagcgccatccatcaaccctacctgtaatcagtgatgccaggagtgtg
ctactggaagcaatacgaaaaggtattcaactacgcaaagtagaagagcagcgtgaacag
gaagctaaacatgaacgcattgaaaatgatgttgccaccatcctgtctcgccgtattgct
gttgaatatagtgattcggaagatgattcagaatttgatgaagtagattggttggagtaa

KEGG   Macaca mulatta (rhesus monkey): 709849
Entry
709849            CDS       T01028                                 

Gene name
WASF3
Definition
(RefSeq) wiskott-Aldrich syndrome protein family member 3
  KO
K06083  WAS protein family, member 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04520  Adherens junction
mcc04666  Fc gamma R-mediated phagocytosis
mcc05132  Salmonella infection
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    709849 (WASF3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    709849 (WASF3)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    709849 (WASF3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    709849 (WASF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    709849 (WASF3)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     709849 (WASF3)
SSDB
Motif
Pfam: WH2 ChaB
Other DBs
NCBI-GeneID: 709849
NCBI-ProteinID: NP_001253527
Ensembl: ENSMMUG00000005055
UniProt: F7DDG6 G7NJT7
LinkDB
Position
17
AA seq 502 aa
MPLVKRNIEPRHLCRGALPEGITSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEAN
NFYIRANSLQDRIDRLAVKVTQLDSTVEEVSLQDINMKKAFKSSTVQDQQVVSKNSIPNP
VADIYNQSDKPPPLNILTPYRDDKKDGLKFYTDPSYFFDLWKEKMLQDTEDKRKEKRRQK
EQKRIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGSLSPDTRS
HASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNR
PQQPPPPPPPQAPEGSQASAPMAPADYGMLPAQIIEYYNPSGPPPPPPPPVIPSAQTAFV
SPLQMPMQPPFPASAGSTHATPPHPPSTGLLVTAPPPPGPPPPPPGPPGPGSSLSSSPMH
GPPVAEAKRQEPAQPPISDARSDLLAAIRMGIQLKKVQEQREQEAKREPVGNDVATILSR
RIAVEYSDSDDDSEFDENDWSD
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgcctttggtgaagaggaacattgagccccggcacttgtgccggggagctctgcctgaa
ggaattaccagcgaacttgaatgtgtgaccaatagtactcttgccgctatcatacgccag
ctgagcagtctgagcaaacatgctgaagacatatttggtgagttgtttaatgaggctaac
aacttctacatcagagcaaattctcttcaagacagaattgatcgcctcgctgtcaaagtc
acccagctggattcaacagtggaagaggtctcactacaggatatcaacatgaaaaaagct
ttcaaaagttccacagtccaagaccagcaggtggtttcaaagaacagcattcctaatcct
gttgctgatatttacaaccagagtgataagccaccgcctctgaacatcctgacaccatac
agagatgacaagaaagatgggctgaagttctatactgatccttcctatttctttgacctc
tggaaagaaaaaatgctacaggacacagaagacaaaaggaaagagaaaaggcgtcaaaag
gagcaaaagcgtatagatggcaccacccgtgaggtgaaaaaggttagaaaagccagaaac
aggcgccaagagtggaatatgatggcatatgacaaagagcttagacccgacaacaggttg
tctcagagtgtgtaccacggagcgtcttccgagggatccctgtccccagatactaggtca
catgcgtcggacgttacggattactcttacccggctactcccaaccattctctgcacccc
cagccggtgaccccttcctacgcagctggtgacgtgccaccacatgggcctgcaagccag
gctgcggagcatgaataccggcccccgtctgcctcggcgaggcacatggccctcaacaga
cctcagcagccgccgcccccgcctccgcctcaggcgccagaggggtcccaggcctctgca
ccgatggctccagcagactacgggatgctcccagcgcagataattgagtattacaaccca
tcaggaccacctcctccgccacctcctcctgtgattccctcggcacaaactgccttcgtc
agccctctccagatgcccatgcagcccccgttccccgcatcagccggctccacgcacgcg
actcctcctcacccaccctccactgggctcctggtcacagccccgccacccccgggcccg
ccacctcccccgccaggccctcctggccctgggtcttctctttcgtcctccccaatgcat
ggccccccagtcgctgaggcaaagcggcaagagccagcacagccacccatcagtgatgct
cgaagcgacctgctcgctgctattcgaatgggaattcagctgaaaaaggtgcaggagcag
cgggagcaggaggccaagcgggagcctgtggggaacgacgtggccaccatcctgtcccgg
cgcattgccgtggagtacagcgactctgacgacgactcagagttcgacgagaacgactgg
tccgactga

KEGG   Macaca mulatta (rhesus monkey): 716082
Entry
716082            CDS       T01028                                 

Gene name
WASF2
Definition
(RefSeq) wiskott-Aldrich syndrome protein family member 2
  KO
K05748  WAS protein family, member 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04520  Adherens junction
mcc04666  Fc gamma R-mediated phagocytosis
mcc04810  Regulation of actin cytoskeleton
mcc05100  Bacterial invasion of epithelial cells
mcc05135  Yersinia infection
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    716082 (WASF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    716082 (WASF2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    716082 (WASF2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    716082 (WASF2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    716082 (WASF2)
   05100 Bacterial invasion of epithelial cells
    716082 (WASF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    716082 (WASF2)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     716082 (WASF2)
SSDB
Motif
Pfam: WH2 WASH_WAHD RasGAP
Other DBs
NCBI-GeneID: 716082
NCBI-ProteinID: XP_014988242
Ensembl: ENSMMUG00000018221
UniProt: F7E520
LinkDB
Position
1
AA seq 498 aa
MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANT
FASRVSSLAERVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPV
LETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRK
EKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYPPTLVYQNGSIGCVEN
VDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHP
PPAPPLGSPAGPKPGFAPPPAPPPPPPPMIGIPSPPPPVGFGSPGTPPPPSPPSFPPHPD
FTAPPPPPPPPATDYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAVPPPL
SDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVE
YSDSEDDSSEFDEDDWSD
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgccgttagtaacgaggaacatcgagccaaggcacctgtgccgtcagacgttgcctagc
gttagaagcgagctggaatgcgtgaccaacatcaccctggcaaatgtcatccgacagctg
ggcagcctgagtaaatatgcagaggacatttttggagagctctttactcaggcaaatacc
tttgcctctcgggtaagctcccttgctgagagggtcgaccgactacaagttaaagtcact
cagctggatcccaaggaagaagaagtgtcactacaaggaatcaacacccgaaaagccttc
agaagctccaccattcaagaccagaagctttttgacagaaactctctcccggtgcctgtc
ttagaaacatacaatacctgtgatactcctccccctctcaacaatcttaccccttacagg
gacgatggaaaagaggcactcaaattctacacagacccttcatacttctttgatctttgg
aaggagaagatgctgcaggacaccaaggatatcatgaaagagaagagaaagcataggaaa
gaaaagaaagataatccaaatcgagggaatgtaaacccacgtaaaatcaagacacgtaag
gaagagtgggagaaaatgaagatgggacaagaatttgtggagtccaaagaaaagctgggg
acttctgggtatccacccaccttggtgtaccagaatggcagcattggctgtgttgaaaac
gtggatgcaagtagctatccgccaccaccacagtcagactctgcttcttcaccttctcct
tccttctccgaggacaacttgcctcctccaccagcagaattcagttacccagtggacaac
caaagaggatctggtttggctggacccaaaagatccagtgtggtcagcccaagccatcca
ccaccagctcctcctctaggctctccagcaggtcctaaacctgggtttgctccaccacct
gcccctccgccacctccgcctccaatgataggcatcccatctccaccaccacctgtagga
tttgggtctccagggacgcctccaccaccctcacccccatctttcccacctcaccctgat
tttactgcccctccacctcctcctccaccaccggcaactgactacccaactctgccacca
cctcccttgtctcagccaacaggaggagcacctcctcctccccctcctcctcctcctccg
gggccccctcctccccctttcactggtgcagatggccagcctgctgtaccaccaccgctt
tctgataccaccaagcccaagtcctccttgcctgctgtgagtgatgcccgtagcgacctg
ctttcagccatccgtcaaggttttcagctgcgcagggttgaggagcagcgggaacaagag
aagcgggatgtcgtgggcaatgacgtggccaccatcttgtctcgtcgcattgctgttgag
tacagtgactcagaagatgattcctctgaatttgatgaggacgactggtcggattaa

DBGET integrated database retrieval system