KEGG   Macaca mulatta (rhesus monkey): 699269
Entry
699269            CDS       T01028                                 

Gene name
CDK1
Definition
(RefSeq) cyclin-dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04110  Cell cycle
mcc04114  Oocyte meiosis
mcc04115  p53 signaling pathway
mcc04218  Cellular senescence
mcc04540  Gap junction
mcc04914  Progesterone-mediated oocyte maturation
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    699269 (CDK1)
   04114 Oocyte meiosis
    699269 (CDK1)
   04115 p53 signaling pathway
    699269 (CDK1)
   04218 Cellular senescence
    699269 (CDK1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    699269 (CDK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    699269 (CDK1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    699269 (CDK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    699269 (CDK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    699269 (CDK1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mcc03032]
    699269 (CDK1)
   03036 Chromosome and associated proteins [BR:mcc03036]
    699269 (CDK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    699269 (CDK1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     699269 (CDK1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     699269 (CDK1)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CMGC group
  CDK family
   699269 (CDK1)
DNA replication proteins [BR:mcc03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    699269 (CDK1)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    699269 (CDK1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   699269 (CDK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like Kdo Seadorna_VP7 Choline_kinase
Other DBs
NCBI-GeneID: 699269
NCBI-ProteinID: NP_001248399
Ensembl: ENSMMUG00000019876
UniProt: H9YZ19
LinkDB
Position
9
AA seq 297 aa
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDVDNQIKKM
NT seq 894 nt   +upstreamnt  +downstreamnt
atggaagattataccaaaatagagaaaattggagaaggtacctatggagttgtgtataag
ggtagacacaaaactacaggtcaagtggtagccatgaaaaaaatcagactagaaagtgaa
gaggaaggggttcctagtactgcaattcgggaaatttctctattaaaagaacttcgtcat
ccaaatatagtcagtcttcaggatgtgcttatgcaggattccaggttatatctcatcttt
gagtttctttccatggatctgaagaaatacttggattctatccctcctggtcagtacatg
gattcttcactcgttaagagttatttataccaaatcctacaggggattgtgttttgtcac
tctagaagagttcttcacagagacttaaaacctcaaaatctcttgattgatgacaaagga
acaattaaactggctgattttggccttgccagagctttcggaatacctattagagtttat
acacatgaggtagtaacactctggtacagatctccagaagtattgctggggtcagctcgt
tactcaactccagttgacatttggagtataggcaccatatttgctgaactagcaactaaa
aaaccacttttccatggggattcagaaattgatcaactcttcaggattttcagagctttg
ggcactcccaataatgaagtgtggccagaagtggaatctttacaggactataagaataca
tttcccaaatggaaaccaggaagcctagcatcccacgtcaaaaacttggatgaaaatggc
ttggatttgctctcgaaaatgttaatctatgatccagccaaacgaatttctggcaaaatg
gcactgaatcatccatattttaatgatgtggacaatcagattaagaagatgtag

DBGET integrated database retrieval system