KEGG   Macaca mulatta (rhesus monkey): 699351
Entry
699351            CDS       T01028                                 

Gene name
PARD6A
Definition
(RefSeq) partitioning defective 6 homolog alpha
  KO
K06093  partitioning defective protein 6
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04144  Endocytosis
mcc04360  Axon guidance
mcc04390  Hippo signaling pathway
mcc04530  Tight junction
mcc05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    699351 (PARD6A)
   04390 Hippo signaling pathway
    699351 (PARD6A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    699351 (PARD6A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    699351 (PARD6A)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    699351 (PARD6A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    699351 (PARD6A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcc03036]
    699351 (PARD6A)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     699351 (PARD6A)
SSDB
Motif
Pfam: PB1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 699351
NCBI-ProteinID: NP_001253493
Ensembl: ENSMMUG00000044865
UniProt: I2CYN5
LinkDB
Position
20
AA seq 345 aa
MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLG
YTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKRAEADSSGLAFASNSLQRRKKGLLLR
PVAPLRTRPPLLISLPQDFRQVSSVIDVDLLPETHRRVRLHKHGSDRPLGFYIRDGMSVR
VAPQGLERVPGIFISRLVRGGLAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSH
NLIVTVKPANQRNNVVRGASGRLTGPPSAGPGPAEPDSDDDSSDLVIENRQPPSSNGLSQ
GPPCWDLHPSCRRPGTRSSLPSLDDQEQASSGWGSRMQDGSGFSL
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggcccggccgcagaggactccggcgcgcagtcccgatagcatcgtcgaggtgaagagc
aaatttgacgccgagttccgacgcttcgcgctgccccgcgcttcggtgagcggcttccag
gagttctcgcggttgctgcgggcggtgcaccagatcccgggcctggacgtgctacttggc
tatacggatgctcacggcgacctgctgcccctcaccaacgacgacagtctgcaccgggcc
ctggccagcgggcccccaccactgcgcctattggtgcagaagcgggcagaagctgactcc
agcggcctggcttttgcctccaactctctgcagcggcgcaagaaagggctcctgctgcgg
ccagtggcaccccttcgcacccgtccacccctgctaatcagcctgccccaagatttccgc
caggtttcgtcagtcatagatgtggacctactgcctgagacccaccgacgggtgcggctg
cacaagcatggttcagaccgccccctgggcttctacatccgagatggcatgagtgttcgt
gtggctccccagggcctggagcgggttccaggaatcttcatctcccgcctggtacgtggg
ggcctggctgagagtacagggctgctggcggtcagtgatgagatccttgaggtcaatggc
attgaagtagccgggaagaccttggaccaagtgacggacatgatggtcgccaacagccat
aacctcattgtcactgtcaagccggccaaccagcgcaataacgtggtgcgaggggcatct
gggcgtttgacaggtcctccctctgcagggcctgggcctgctgagcctgatagtgatgat
gacagcagtgacctggtcattgagaaccgccagcctcccagttccaatgggctgtctcag
gggcccccatgctgggacctgcaccctagctgccgacgtcctggtacccgcagctctctg
ccctccctggatgaccaggagcaggccagttctggctgggggagtcgcatgcaagatggt
agtggcttcagcctctga

KEGG   Macaca mulatta (rhesus monkey): 699479
Entry
699479            CDS       T01028                                 

Gene name
PARD6G
Definition
(RefSeq) partitioning defective 6 homolog gamma
  KO
K06093  partitioning defective protein 6
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04144  Endocytosis
mcc04360  Axon guidance
mcc04390  Hippo signaling pathway
mcc04530  Tight junction
mcc05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    699479 (PARD6G)
   04390 Hippo signaling pathway
    699479 (PARD6G)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    699479 (PARD6G)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    699479 (PARD6G)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    699479 (PARD6G)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    699479 (PARD6G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcc03036]
    699479 (PARD6G)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     699479 (PARD6G)
SSDB
Motif
Pfam: PB1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 699479
NCBI-ProteinID: XP_001090088
Ensembl: ENSMMUG00000039029
LinkDB
Position
18
AA seq 376 aa
MNRSFHKSQTLRFYDCSAVEVKSKFGAEFRRFSLNRHKPGKFEDFYKLVVHTHHISNSDV
TIGYADVHGDLLPINNDDNFCKAVSSANPLLRVFIQKREEAERGSLGAGSLCRRRRALGA
LRDEGPRRRAHLDIGLPRDFRPVSSIIDVDLVPETHRRVRLHRHGCEKPLGFYIRDGASM
RVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVNGIEVAGKTLDQVTDMMIANS
HNLIVTVKPANQRNNVVRGGRALGSSGPPSDGTAGLLGPPAPRVLQNFHPDEAESDEDND
VVIEGTLEPARPPQAPGAPAGSLSRVNGAGLAQRLQRDLALDGGLQRLLSSLRADPRHSL
ALPPGGVEEHGPAVTL
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgaaccggagttttcacaagtctcagaccttgcgattctacgactgcagcgcggtggaa
gtcaagagcaagtttggggcggaattccgaaggttctctctgaaccgtcataagcctggg
aagtttgaagatttctacaagctggttgtacacacccaccatatctccaacagtgatgta
actattggctacgcagatgtacacggagacctgctgcccatcaacaatgacgacaacttc
tgcaaggcggtttccagtgcaaaccccctgctcagggtcttcatccagaaacgagaggag
gccgagcgtggcagcctcggcgcgggctcgctgtgcaggcggaggcgggcgctgggcgcg
ctgcgtgacgaaggaccccggcggcgcgcacacctggacatcggcctcccgcgcgacttc
cgccccgtgtcgtccatcatcgatgtggacctggtccccgagacgcaccggcgagtgcgg
ctgcaccggcacggctgcgagaagccgctgggcttctacatccgcgacggcgccagcatg
cgcgtgaccccgcacgggctggagaaggtgcccggcatcttcatctcgcgcatggtcccc
gggggcctggcggagagcaccgggctgctggctgtgaacgacgaggtcctggaagtgaac
ggcattgaggtggccgggaagacgctggaccaggtcacggacatgatgatcgccaacagc
cacaacctcatcgtcaccgtcaagcccgccaaccagcgcaacaacgtggtgcgcggcggc
cgcgcgctgggcagctcgggacccccctcggacggcaccgcgggcctcctgggtcccccc
gccccgcgcgtcctgcagaacttccaccccgacgaggcggagagcgacgaggacaacgac
gtggtcatcgagggcacgctggagcccgcacgccccccccaggccccgggcgcccccgcg
ggcagcctctcccgggtcaacggcgcgggcctggcgcagcggctgcagcgggacctggcc
ctggacggcggcctccagcggctgctcagctccctgcgggccgacccacgtcacagcctg
gccctgccaccgggcggcgtggaggagcacgggcccgcggtcacgctctag

KEGG   Macaca mulatta (rhesus monkey): 712004
Entry
712004            CDS       T01028                                 

Gene name
PARD6B
Definition
(RefSeq) partitioning defective 6 homolog beta
  KO
K06093  partitioning defective protein 6
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04144  Endocytosis
mcc04360  Axon guidance
mcc04390  Hippo signaling pathway
mcc04530  Tight junction
mcc05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    712004 (PARD6B)
   04390 Hippo signaling pathway
    712004 (PARD6B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    712004 (PARD6B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    712004 (PARD6B)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    712004 (PARD6B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    712004 (PARD6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcc03036]
    712004 (PARD6B)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     712004 (PARD6B)
SSDB
Motif
Pfam: PB1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 712004
NCBI-ProteinID: XP_015004269
Ensembl: ENSMMUG00000038148
UniProt: I0FVR0
LinkDB
Position
10
AA seq 372 aa
MNRSHRHGAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLV
GYADIHGDLLPINNDDNYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLTNVL
RPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVR
VTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSR
NLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLLGSPQHIEPSCEPEDEDSDEDDIIIED
NGVPQQIPKAVPNTESLESLTQIELSFESGQNGFIPSNEVSLAPIASGSNTEFETHAPDQ
KLLEEDGTIITL
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgaaccgcagccaccggcacggggcgggcagcggctgcctgggcaccatggaggtgaag
agcaagtttggagctgaatttcgtcggttttcgctggaaagatcaaaacctggaaaattt
gaggagttttatggattactacaacatgttcataagatccccaatgttgacgttttggta
ggctatgcagacatccatggagacttactacctataaataatgatgataattatcacaaa
gctgtttcaacggccaatccactgcttaggatatttatacaaaagaaggaagaagcagac
tacagtgcctttggtacagacacgctaataaagaagaagaatgttttaaccaacgtattg
cgtcctgacaaccatagaaaaaagccacatatagtcattagtatgccccaagactttaga
cctgtgtcttctattatagacgtggatattcttccagaaacacatcgtagggtacgtctt
tacaaatatggcactgagaaacccctaggattctacatccgggatggctccagtgtcagg
gtaacaccacatggcttggaaaaggttccagggatctttatatccaggcttgtcccagga
ggtctggctcaaagtacaggactattagctgttaatgatgaagttttagaagttaatggc
atagaagtttcagggaagagccttgatcaagtaacagacatgatgattgcaaatagccgt
aacctcatcataacagtgagaccggcaaaccagaggaataatgttgtgaggaacagtcgg
acttctggcagttctggccagtctaccgataacagccttcttggctccccacagcacatt
gaaccaagctgtgagccagaggatgaagacagcgatgaagatgacattatcattgaagac
aatggagtgccacagcagattccaaaagctgttcctaataccgagagcctggagtcatta
acacagatagagctaagctttgagtctggacagaatggctttattccctctaatgaagtg
agcttagcacccatagcaagtggctcaaacacggaatttgaaacacatgctccagatcaa
aaactcttagaagaagatggaacaatcataacattatga

DBGET integrated database retrieval system