KEGG   Macaca mulatta (rhesus monkey): 699467
Entry
699467            CDS       T01028                                 

Gene name
CD3E
Definition
(RefSeq) T-cell surface glycoprotein CD3 epsilon chain isoform X1
  KO
K06451  T-cell surface glycoprotein CD3 epsilon chain
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04640  Hematopoietic cell lineage
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc05142  Chagas disease
mcc05162  Measles
mcc05166  Human T-cell leukemia virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    699467 (CD3E)
   04660 T cell receptor signaling pathway
    699467 (CD3E)
   04658 Th1 and Th2 cell differentiation
    699467 (CD3E)
   04659 Th17 cell differentiation
    699467 (CD3E)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    699467 (CD3E)
  09163 Immune disease
   05340 Primary immunodeficiency
    699467 (CD3E)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    699467 (CD3E)
   05170 Human immunodeficiency virus 1 infection
    699467 (CD3E)
   05162 Measles
    699467 (CD3E)
   05169 Epstein-Barr virus infection
    699467 (CD3E)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    699467 (CD3E)
CD molecules [BR:mcc04090]
 Proteins
  699467 (CD3E)
SSDB
Motif
Pfam: Ig_5 Ig_4 ITAM Ig_2 Ig_3 P5-ATPase ig Virul_fac_BrkB
Other DBs
NCBI-GeneID: 699467
NCBI-ProteinID: XP_014971302
Ensembl: ENSMMUG00000017593
UniProt: G7NCB9 A0A663DHX9
LinkDB
Position
14
AA seq 198 aa
MQSGTRWRVLGLCLLSIGVWGQDGNEEMGSITQTPYHVSISGTTVILTCSQHLGSEVQWQ
HNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDVMA
VATIVIVDICITLGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYE
PIRKGQQDLYSGLNQRRI
NT seq 597 nt   +upstreamnt  +downstreamnt
atgcagtcgggcactcgctggagagttctgggcctctgcctcttatcaattggcgtttgg
gggcaagatggtaatgaagaaatgggtagtattacacagacaccatatcacgtctccatc
tctggaaccacagtaatactgacatgctctcagcatcttggatctgaagtacaatggcaa
cacaatggtaaaaacaaagaagattctggggatcgcctgtttctgccggaattttcagaa
atggagcaaagtggttattatgtctgctaccccagaggaagcaatccagaggatgcgagc
catcatctctacctgaaggcaagagtgtgtgagaactgcatggagatggatgtgatggcg
gtggccacaattgtcatagtggacatctgcatcactctgggcttgctgctgctggtttac
tactggagcaagaatagaaaggccaaggccaagcctgtgacacgaggagcaggtgctggc
ggcaggcaaaggggacaaaacaaggagaggccaccacctgttcccaacccagactatgag
cccatccggaaaggccagcaggatctgtattctggcctgaatcagagacgcatctga

DBGET integrated database retrieval system