KEGG   Macaca mulatta (rhesus monkey): 699524
Entry
699524            CDS       T01028                                 

Gene name
FLNA
Definition
(RefSeq) filamin-A isoform X1
  KO
K04437  filamin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04510  Focal adhesion
mcc05132  Salmonella infection
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    699524 (FLNA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    699524 (FLNA)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    699524 (FLNA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    699524 (FLNA)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     699524 (FLNA)
  Intermediate filaments
   Intermediate filament-binding proteins
    699524 (FLNA)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   699524 (FLNA)
SSDB
Motif
Pfam: Filamin CH Y_Y_Y Big_3_5 CFSR YtkA
Other DBs
NCBI-GeneID: 699524
NCBI-ProteinID: XP_001091073
Ensembl: ENSMMUG00000013668
UniProt: F7GCM2
LinkDB
Position
X
AA seq 2647 aa
MSSSHSRAGQSAAGAAPGGGADTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVI
QDPAGQKGTVEPQLEARGDSTYRCTYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNP
SACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGF
EYYPTVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVE
AIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSDDIRLSPFM
ADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVE
ALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVA
KTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTP
RGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAK
AAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSP
FSVAVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKV
EPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPVEAVAPTKPSKVKAFGPGLQGG
SAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF
ADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSE
AGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGTYKVE
YTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVET
RGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKV
PVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVV
DNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGV
PASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILI
KYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG
KGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYIICVRFGGEHVPNSPFQVTA
LAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDMTSLRPFDLVIPFTIK
KGEITGEVRMPSGKVAQPAITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYV
DYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTC
SVSYLPVLPGDYSILVKYNEQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDL
SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS
QSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDG
TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHC
DLSLKIPEISIQDMTAQVTSPSGKSHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQH
VPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSK
AEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSL
QESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVY
LIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAG
ALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPR
LVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADAAKVVAKGLGLSKAYIGQKSSFTV
DCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGS
PYRVVVP
NT seq 7944 nt   +upstreamnt  +downstreamnt
atgagtagctcccactctcgggcgggccagagcgcagcaggcgcggctccgggtggtggc
gctgacacgcgggacgcggagatgccggccaccgagaaggacctcgcggaggacgcgccg
tggaagaagatccagcagaacactttcacgcgctggtgcaacgagcacctgaagtgcgtg
agcaagcgcatcgccaacctgcagacggacctgagcgacgggctgcggctcatcgcgctg
ctggaggtgctcagccagaagaagatgcaccgcaagcacaaccagcggcccactttccgc
caaatgcagcttgagaatgtgtcggtggcgctcgagttcctggaccgcgagagcatcaaa
ctggtgtccatcgacagcaaggccatcgtggacgggaacctgaagctgatcctgggcctc
atctggaccctgatcctgcactactccatctccatgcccatgtgggatgaggaggaggat
gaggaggccaagaagcagacccccaagcagaggctcctgggctggatccagaacaagctg
ccacagctgcccatcaccaacttcagccgagactggcagagcggccgggccctgggtgcc
ctggtcgacagctgtgccccgggcctgtgtcctgactgggactcttgggatgccagcaag
cctgtgaataatgcacgagaggccatgcagcaggcggatgactggctgggcatcccccag
gtgatcacccccgaggagattgtggaccccaacgtggatgagcattctgtcatgacctac
ctgtcccagttccccaaggccaagctgaagccaggggcacccttgcggcccaaactgaac
ccgaagaaagcccgtgcctacgggccaggcattgagcccacaggcaacatggtgaagaag
cgggcggagttcactgtggagaccagaagtgccggccagggagaggtgctggtgtacgtg
gaggacccggccggacaccaggaggaggcaaaagtgactgccaataatgacaagaaccgc
accttttctgtctggtacgtccccgaggtgacggggactcataaggtcactgtgctattt
gctggccagcacatcgccaagagccccttcgaggtgtatgtggataagtcacagggtgac
gccagcaaagtgacagcccaaggccccggcctggagcccagtggcaacatcgccaacaag
accacctactttgagatctttacagcaggagctggcacgggcgaggttgaggttgtgatc
caggaccccgcgggacagaagggcacggtagagcctcagctggaggcccggggcgacagc
acataccgctgcacctaccagcccaccatggagggtgtccacaccgtgcacgtcacgttt
gccggcgtgcccatccctcgcagcccctacactgtcactgttggccaagcctgtaacccg
agtgcctgccgggcagtcggccggggcctccagcccaagggtgtgcgggtgaaggagaca
gccgacttcaaggtgtacacaaagggcgctggcagtggggagctgaaggtcaccgtgaag
ggccccaagggagaggagcgcgtgaagcagaaggacctaggggatggcgtgtatggcttc
gagtattaccccacggtccctgggacctatatcgtgaccatcacatggggcggtcagaac
attgggcgcagtcccttcgaggtgaaggtgggcaccgagtgtggcaatcagaaggtgcgg
gcatggggccctgggctggagggcggcgtcgttggcaagtcagcagactttgtggtggag
gctattggggacgacgtgggcaccctgggcttctcggtggaaggtccatcgcaggccaag
atcgaatgtgacgacaagggtgatggctcctgtgatgtgcgctactggccgcaggaggct
ggcgagtatgctgttcacgtgctgtgcaacagtgacgacatccgcctcagccccttcatg
gctgacatccgtgatgcaccccaggacttccacccagacagggtgaaggcacgtgggcct
ggattggagaagacaggtgtggccgtcaacaagccagcagagttcacagtggatgccaag
cacggtggcaaggccccactccgggtccaagtccaggacaatgaaggctgccctgtggag
gcattggtcaaggacaatggcaacggcacttacagctgttcctacgtgcccaggaagcca
gtgaagcacacagccatggtgtcctggggaggcgtcagcatccccaacagccccttcagg
gtgaatgtgggagctggcagccaccccaacaaggtcaaagtatatggccccggagtggcc
aagacagggctcaaggcccacgagcccacctacttcactgtggactgcgccgaggctggc
cagggggatgtcagcatcggtatcaagtgtgcccctggagtggtaggtcccgctgaagct
gacatcgacttcgacatcatccgcaacgacaatgacaccttcacggtcaagtacacaccc
cggggggctggcagctacaccattatggtcctctttgctgaccaggccacgcccaccagc
cccatccgagtcaaggtggagccctctcatgacgccagtaaggtgaaggctgagggccct
ggcctcagtcgcactggtgtcgagcttggcaagcccacccacttcacagtcaatgcgaaa
gccgctggcaaaggcaagctggacgtccagttctcaggactcaccaagggggatgcagtg
cgagacgtggacatcatcgaccaccatgacaacacctacacagtcaagtacacacctgtg
cagcagggtccagtaggcgtcaatgtcacttatggaggggatcccatccctaagagccct
ttctcggtggcagtatctccaagcctggacctcagcaagatcaaggtgtctggcctggga
gagaaggtggacgttggcaaagaccaggagttcacagtcaaatcaaagggtgctggtggt
caaggcaaagtggcatccaagattgtgggcccctcaggtgcagcagtgccctgcaaggtg
gagccaggcctaggagctgacaacagtgtggtgcgcttcgtgcctcgtgaggaagggccc
tatgaggtggaggtgacctatgacggcgtgcctgtgcctggcagcccctttcctgtggaa
gctgtggcccctaccaagcctagcaaggtgaaggcgtttgggccggggctgcagggaggc
agtgcaggctcccccgcccgcttcaccattgacaccaagggcgccggcacaggtggcctg
ggcttgacagtggagggcccctgcgaggcacagctcgagtgcttggacaacggggacggc
acatgttccgtgtcctatgtgcccaccgagcccggggactacaacatcaacatccttttc
gctgacacccacatccctggctccccattcaaggcccatgtggttccctgctttgacgca
tccaaagtcaagtgctcaggccctgggctggagcgggccaccgctggggaagtgggccaa
ttccaagtagactgctcgagtgcaggcagtgcagagctgaccattgagatctgctcagag
gcggggctgccagccgaggtgtacatccaggaccacggcgacggcacgcacactatcaca
tacattcctctctgccccggggcctacactgtcaccatcaagtacggcggccagcctgtg
cccaacttccccagcaagctgcaggtggagcccgcagtggacacttccggcgtccagtgt
tacgggcctgggattgagggccagggtgtcttccgtgaggccaccactgagttcagtgtg
gacgcccgggctctgacacagaccggagggccgcacgtcaaggcccgtgtggccaacccc
tcaggcaacctgacagagacctacgttcaggaccgaggcgacggcacgtacaaagtggag
tacacgccttacgaggagggactgcactcggtggacgtgacctacgacggcagccccgtg
cccagcagccccttccaggtgcccgtgactgagggctgcgacccctcccgggtgcgtgtc
catgggccaggcatccaaagtggcaccaccaacaagcccaacaagttcactgtggagacc
aggggagctggcacgggcggcctgggcctggctgtagagggcccctccgaggccaagatg
tcctgcatggataacaaggatggcagctgctcagttgagtacattccttatgaggctggc
acctacagcctcaatgtcacctatggtggccatcaagtgccaggcagtcctttcaaggtc
cctgtgcatgatgtgacagatgcgtccaaggtcaagtgctctgggcccggcctgagccca
ggcatggttcgtgccaaccttcctcagtccttccaggtggacacaagcaaggctggtgtg
gccccactgcaggtcaaagtgcaagggcccaaaggcctggtggagccagtggacgtggtg
gacaacgctgatggcacccagaccgtcaattatgtgcccagccgagaagggccctacagc
atctcagtgctgtatggagatgaagaggtgccccggagccccttcaaggtcaaggtgctg
cctactcatgatgccagcaaggtgaaggccagtggccccggactcaacaccactggcgtg
cccgccagcctgcccgtggagttcaccatcgatgcaaaggatgctggggagggcctgctg
gctgtccagatcacggatccggaaggcaagccgaagaagacacacatccaagacaaccat
gacggcacgtatacagtggcctatgtgccagatgtgacgggtcgctacaccatcctcatc
aagtatggtggtgacgagatccccttctccccgtaccgcgtgcgtgccgtgcccaccggg
gacgccagcaagtgcacagtcacagtgtcaatcggaggtcacgggctaggtgctggcatc
ggccccaccatccagattggggaggagacggtgatcaccgtggacactaaggcagcaggc
aaaggcaaagtgacatgcaccgtgtgcacgcctgatggctcagaggtagatgtggacgtg
gtggagaatgaggacggcacttttgacatcttctacacggccccccagccgggcaaatac
attatctgtgtgcgctttggtggcgagcacgtgcccaacagccccttccaagtgacggct
ctggctggggaccagccctcggtgcagcccccgctacggtctcagcagctggccccacag
tatacctacgcccagggcggtcagcagacttgggccccagagaggcccctggtgggtgtc
aatgggctggatatgaccagcctgaggccctttgaccttgtcatccccttcaccatcaag
aagggtgagatcacaggggaggttcggatgccctcaggcaaggtggcacagcctgccatc
actgacaacaaagatggcaccgtgaccgtacggtatgcacccagtgaggctggcctgcac
gagatggacatccgctatgacaacatgcacatcccaggaagccccttgcagttctatgtg
gattatgtcaactgcggccatgtcactgcctatggacctggcctcacccacggagtagtg
aacaagcctgccactttcaccgtcaacaccaaagatgcaggagaggggggcctgtctctg
gccatcgagggcccgtccaaagcagaaatcagctgcactgacaaccaggatgggacatgc
agcgtctcctacctgcctgtgttgccgggtgactacagcatcctagtcaagtacaatgaa
cagcacatcccaggcagccccttcacggcccgggtcacaggtgacgactccatgcgtatg
tcccacctaaaggtgggctctgctgccgacatccccatcaacatctcagagacggatctc
agcctgctgacagccactgtggtcccgccctcaggccgggaggagccctgtttgctgaag
cggctgcgtaatggccacgtggggatttcattcgtgcccaaggagacaggggagcacctg
gtgcacgtgaagaaaaacggccagcacgtggccagcagccccatcccggtggtgatcagc
cagtcggaaatcggggatgccagtcgcgttcgggtctctggccagggccttcacgaaggc
cacacctttgagcctgcggagtttatcattgatacccgagatgcaggctatggtgggctc
agcctgtccattgagggccccagcaaggtggacatcaacacagaggacctggaggacggg
acgtgcagggtcacctactgccccacagagcctggcaactacatcatcaacatcaagttt
gccgaccagcacgtgcctggcagccccttctctgtgaaagtgacaggcgagggccgggtg
aaagagagcatcacccgcaggcgtcgggctccttcagtggccaacgttggcagtcattgt
gatctcagcctaaagatccctgaaattagcatccaggatatgacagcccaggtgaccagc
ccatcgggcaagagccatgaggccgagatcgtggaaggggagaaccacacctactgtatc
cgctttgttcctgctgagatgggcacacacacagtcagcgtcaagtacaagggccagcac
gtgcctgggagccccttccagttcaccgtggggcccctaggggaagggggagcccacaag
gtccgagctgggggccctggcctggagagggctgaagctggagtgccagccgaattcagt
atctggacccgggaagctggtgccggaggcctggccattgctgtcgagggccccagcaag
gctgagatctctttcgaggaccgcaaggacggctcctgtggtgtggcttatgtggtccag
gagccaggtgactacgaagtctcagtcaagttcaacgaggaacacattcccgacagcccc
ttcgtggtgcctgtggcttctccgtctggcgatgcccgccgcctcactgtttctagcctt
caggagtcagggctaaaggtcaaccagccagcctcttttgcagtcagcctgaatggggcc
aagggggcaatcgatgccaaggtgcacagcccctcaggagccctggaggagtgctatgtc
acagaaattgaccaagataaatatgctgtgcgcttcatccctcgggagaatggcgtttac
ctgattgacgtcaagttcaatggcacccacatccctggaagccccttcaagatccgagtt
ggggagcccggtcatggaggggacccaggcttggtgtctgcttacggagcaggcctggaa
ggcggtgtcacagggagcccagctgagttcatcgtgaacacgagcaatgcaggagctggt
gccctgtcggtgaccattgatggcccctccaaggtgaagatggattgccaggagtgccct
gagggctaccgtgtcacctatacccccatggcacctggcagctacctcatctccatcaag
tatggtggcccctatcacattgggggcagccccttcaaggccaaagtcacaggcccccgt
ctcgtcagcaaccacagcctccacgagacatcatcagtatttgtagactctctgaccaag
gccacctgcgcccctcagcatggggctccgggtcctgggcctgctgacgccgccaaggtg
gtggccaagggcctgggactgagcaaggcctacataggccagaagagcagcttcacggta
gactgcagcaaagcaggcaacaacatgctgctggtgggggttcatggcccaaggaccccc
tgcgaggagatcctggtgaagcacgtgggcagccggctctacagcgtgtcctacctgctc
aaggacaagggggagtacacactggtggtcaagtggggcgacgagcacatcccaggcagc
ccctaccgcgttgtggtgccctga

KEGG   Macaca mulatta (rhesus monkey): 700223
Entry
700223            CDS       T01028                                 

Gene name
FLNC
Definition
(RefSeq) filamin-C isoform X1
  KO
K04437  filamin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04510  Focal adhesion
mcc05132  Salmonella infection
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    700223 (FLNC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    700223 (FLNC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    700223 (FLNC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    700223 (FLNC)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     700223 (FLNC)
  Intermediate filaments
   Intermediate filament-binding proteins
    700223 (FLNC)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   700223 (FLNC)
SSDB
Motif
Pfam: Filamin CH Big_3_5 CFSR YtkA Invasin_D3
Other DBs
NCBI-GeneID: 700223
NCBI-ProteinID: XP_028702095
Ensembl: ENSMMUG00000006296
LinkDB
Position
3
AA seq 2725 aa
MMNNSGYSDAGLGLGDETDEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTDL
QRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDSK
AIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPITN
FNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEI
VDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFTV
QTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNIE
RSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGR
RDTVEVALEDKGDSTFRCTYRPVMEGPHTVHVAFAGAPITRSPFPVHVSEACNPNACRAS
GRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYPV
VPGKYVVTITWGGYAIPRSPFEVQVSPEAGVQKVRAWGPGLETGQVGKSADFVVEAIGTE
VGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILP
APPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVIP
NGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGLK
ANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGR
YTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKA
KLDVQFAGTAKGEAVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNV
APPLDLSKIKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGG
AEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGTP
APFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHI
PGSPFKATIRPVFDPSKVRASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVKA
EVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPGV
EPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYE
EGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAGT
GGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDV
VDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDGT
HTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLPV
EFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDE
IPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTC
TVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPLPH
EEEPSEVPQLRQSYAPPRPGARPTHWATEEPVVPVEPMESMLRPFNLVIPFAVQKGELTG
EVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSR
HVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLP
TAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSQLTAS
IRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGD
ASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTY
CPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKI
PGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPA
VFGDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKMEAAEIVEGEDSAYSVRFVP
QEMGPHTVAVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTR
EAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVP
VASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYISELD
SDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTT
GVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGP
QHIVGSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVT
RGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKE
KGDYILIVKWGDESVPGSPFKVKVP
NT seq 8178 nt   +upstreamnt  +downstreamnt
atgatgaacaacagcggctactcagacgccggcctcggcctgggcgacgagacggacgag
atgccgtccacggagaaggacctggcggaggacgcgccgtggaagaagatccagcagaac
acattcacgcgctggtgcaatgagcacctcaagtgcgtgggcaagcgcctgaccgacctg
cagcgcgacctcagcgacgggctccggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgtaccgcaagttccacccgcgccccaactttcgccaaatgaagctggagaacgtg
tccgtggccctcgagttcctggagcgtgagcacatcaagcttgtgtccatagacagcaag
gccatcgtggatgggaacctgaagctgatccttggcctgatctggacgctgatcctgcac
tactccatctccatgcccatgtgggaggatgaagatgatgaggacgcccgcaaacagaca
cccaagcagcgactgctcggctggatccagaacaaggtgccccagctgcccatcaccaac
ttcaaccgtgactggcaggatggcaaagctctgggtgccctggtggacaactgtgcccct
ggtctctgccccgactgggaggcctgggatcccaaccagcccgtggagaacgcccgagag
gccatgcagcaggccgacgactggcttggggtgccccaggtcattgcccctgaggagatc
gtggaccccaacgtggatgagcattctgttatgacatatctgtcccagttccccaaggcc
aagctcaaacccggcgcccctgttcgatccaagcagctgaaccccaagaaagccatcgcc
tatgggcctggcatcgagccacagggcaacacagtgctgcagcctgcccacttcaccgtg
cagacggtggacgcaggcgtgggcgaggtgctggtctacatcgaagaccctgaaggccac
accgaggaggccaaggtggttcccaacaatgacaaagaccgcacctacgctgtctcctat
gtgcccaaggtcgctgggttacacaaggtgaccgtgctctttgctggccagaacattgaa
cgcagtccctttgaggtgaacgtgggcatggccctgggagatgccaacaaggtgtcagcc
cgtggtcctggcctggaacctgtgggcaatgtggccaacaaacccacctactttgacatc
tacactgcaggggccggcactggcgatgttgctgtggtgatcgtggacccacagggccgg
cgggacacagtggaggtcgccctggaggacaagggtgacagcacgttccgctgcacatac
agacctgtcatggaggggccacacaccgtacatgtggcctttgcgggtgcccccatcacc
cgcagtcccttccctgtccacgtgtcagaagcctgtaaccccaatgcctgccgcgcctct
gggcgaggcctgcagcccaagggtgttcgtgtgaaagaggtggctgacttcaaggtgttt
accaagggtgccggcagcggggagctcaaggtcacagtcaaggggccaaagggcacagag
gagccagtgaaggtgcgggaggctggggacggtgtgttcgagtgcgagtactacccggta
gtgcctgggaagtatgtggtgaccatcacgtggggcggctatgccatccctcgcagcccc
tttgaggtacaggtgagcccagaggcaggagtgcaaaaggtccgggcctggggtcctggt
ttggagactggccaggtgggcaagtcagctgactttgtggtggaagccattggcaccgag
gtggggacactgggcttctccatcgaggggccctcacaagccaagatcgaatgtgatgac
aagggggatggctcctgcgatgtgcggtactggcctacggagcctggggagtacgctgtg
cacgtcatctgtgacgacgaggacatccgagactcacccttcattgcccacatcttgccc
gccccacctgactgcttcccagataaggtgaaggcctttgggcctggcctggagcctaca
ggctgcatcgtggacaagcccgctgagttcaccattgatgcccgtgcagctggcaaggga
gacctgaagctctatgcccaggacgcggacggctgtcccatcgacatcaaggtgatcccc
aacggcgatggcaccttccgctgctcctacgtgcccaccaagcccattaagcacaccatc
atcatctcctggggaggcgtaaacgtgcccaagagccccttccgggtgaacgtgggcgag
ggcagccaccccgagcgggtgaaagtgtacggccccggcgtggagaagacgggcctcaag
gccaacgagcccacctacttcaccgtggactgcagcgaggcagggcaaggtgacgtgagc
attggcatcaagtgcgcccccggcgtggtgggccctgcagaggctgacatcgacttcgac
atcatcaagaatgacaatgacaccttcaccgtcaagtacacgccaccgggggcgggccgc
tacaccatcatggtgctgtttgccaaccaggagatccccgccagccccttccacatcaag
gtggacccatcccacgatgccagcaaagtcaaggccgagggccctgggctgaatcgcaca
ggtgtggaagttgggaagcccacccacttcacggtgctgaccaagggagccggcaaggcc
aagttggatgtgcagtttgcagggacagccaagggcgaggctgtgcgggactttgagatc
atagacaaccatgactattcctacactgtcaagtacaccgctgtccagcagggcaacatg
gcagtgacagtgacctacggcggggaccctgtccccaagagcccctttgtggtgaatgtg
gcacccccgctggacctcagcaaaatcaaagttcagggcctcaatagcaaggtggctgtg
ggacaggaacaagcattctctgtgaacacacgaggggctggcggtcaaggccaactggat
gtgcggatgacttcgccctctcgccggcccatcccctgcaagctggagccaggcggcgga
gcggaagcccaggctgtgcgctacatgcccccggaggaggggccctacaaggtggacatc
acctacgatggtcacccagtgcctggcagcccctttgctgtggagggtgtcctgccccct
gatccctccaaggtctgtgcttacggccccggtctcaagggtggactggtaggcaccccc
gcaccattctctatcgacaccaagggggctggcacaggtggcctggggctgaccgtggag
ggcccctgcgaggccaagatcgagtgccaggacaatggtgatggctcatgtgctgtcagc
tacctgcccacggagcctggcgagtacaccatcaacatcctgtttgccgaagcccacatc
cctggctcgcccttcaaagctaccatccggcccgtgtttgacccaagcaaggtgcgggcc
agtgggccgggcctggagcgcggcaaggccggtgaggcagccaccttcactgtggactgc
tcagaggcaggcgaggcagagctgaccattgagatcctgtcggatgccggggtcaaggcc
gaggtgctgattcacaataatgcggatggcacctaccacatcacctacagccctgccttc
cccggcacctacaccattaccatcaaatatggcgggcatccggtgcccaaattccccacc
cgcgtccatgtgcagcctgcggtcgataccagtggcgtcaaggtctcagggcctggtgtt
gagccacatggtgtcctgcgggaggtgaccactgagttcactgtggatgcaagatcctta
acagccacaggcggcaaccacgtgacggctcgcgtgctcaacccctcgggggccaagaca
gacacttatgtgacagacaatggggacggcacctaccgagtacagtacaccgcctacgag
gagggcgtgcatttggtggaggtcctgtatgatgaggtcgctgtgcccaagagccccttc
cgagtgggtgtcactgagggctgtgatcccacccgcgtccgggccttcgggccaggcctg
gagggtggcttggttaacaaggccaaccgcttcactgtggagaccaggggagccggcacc
gggggccttggcctagccatcgagggtccctcggaagccaagatgtcctgcaaggacaac
aaggatggtagctgcactgtggagtacatccccttcacccctggagactatgacgtcaac
atcaccttcggggggcggcccatcccagggagcccattccgggtgccggtgaaggatgtg
gtggaccctggaaaggtgaagtgctcggggccagggctgggggctggtgtcagggcccgg
gtcccccagaccttcacagtggactgcagtcaagctggccgggcacccctgcaggtggct
gtgctgggccccacaggtgtggccgagcctgtggaggtgcgggacaatggagatggcacc
cacactgtccactacaccccagccactgatgggccctacacggtagctgtcaagtatgcg
gaccaggaggtgccacgcagccctttcaagatcaaggtccttccagctcatgatgccagc
aaggtgcgagccagcggcccaggcctcaatgcctctgggatccctgccagtctgcctgtg
gagttcaccatcgacgcaagggacgcgggcgaggggttgctcactgtccagatcctggac
cccgagggtaaacccaagaaggccaacatccgggacaatggggatggcacgtacactgtg
tcctacctgccagacatgagcggccggtacaccatcaccatcaagtatggcggcgatgag
atcccctactcacccttccgcatccatgctctgcccaccggggacgccagcaagtgcctc
gtcacagtgtccattggaggccacggcctgggtgcctgcctgggcccccgaatccagatt
gggcaggagacggtgatcacagtggatgccaaggcagccggcgaggggaaggtgacatgc
acggtgtccacgccggatggggcagagctcgatgtggacgtggttgagaaccacgatggt
acctttgacatctactacacagcgcccgagccgggcaagtacgtcatcaccatccgcttc
gggggcgagcacatcccgaacagccccttccacgtactggcgtgtgaccccctgccgcat
gaggaggagccctctgaagtgccacagctgcgccagtcctacgctcctccccggcctggc
gcccgccccacacactgggccacagaggagccagtggtgcctgtggagccaatggaatcc
atgctgaggcccttcaacctggtcatcccctttgcggtgcagaaaggggagctcacagga
gaggtgcggatgccctcagggaagacggcgcggcccaacatcaccgacaacaaggacggc
accatcacggtgaggtacgcacccaccgagaaaggcctgcaccagatggggatcaagtat
gacggcaaccacatccctgggagccccttgcagttttatgtagatgccatcaacagccgc
catgtcagtgcctatgggccaggcctgagccatggcatggtcaacaagccagccaccttc
accattgtcaccaaagatgctggagaagggggtctgtcgctggccgtggagggcccatcc
aaggcagagatcacctgtaaggacaacaaggatggcacctgcaccgtgtcctacctgccg
accgcacctggagactacagcatcatcgtgcgcttcgatgacaagcacatcccggggagc
cccttcaccgccaagatcacaggcgatgactccatgaggacctcacagctgaacgtgggt
acctccacggatgtgtcgctgaagatcaccgagagtgatctgagccagctaaccgccagc
atccgtgccccctcgggcaacgaggagccctgtctgctgaagcgcctgcccaaccggcac
atcgggatctccttcactcccaaggaggtgggggagcatgtggtgagcgtgcgcaagagt
ggcaagcacgtcaccaacagccccttcaagatcctggtggggccatctgagatcggggac
gccagcaaggtgcgggtctggggcaagggcctttctgagggacacacgttccaggtggcg
gagttcatcgtggatactcgcaatgcagggtatgggggcttggggctgagtattgaaggc
ccaagcaaggtggacatcaactgtgaggacatggaggacgggacatgcaaagtcacctac
tgccccaccgagcccggcacctatatcatcaacatcaagtttgctgacaagcacgtgcct
ggaagccccttcactgtgaaggtgaccggcgagggccgcatgaaggaaagcattacccgg
cggagacaggcgccttccatcgccaccattggcagcacctgtgacctcaacctcaagatc
ccagggaactggttccagatggtgtctgcccaggagcgcctgacgcgcaccttcacacgc
agcagccacacctacacccgcacggagcgcacggaaatcagcaagacgcggggcggggag
acaaagcgcgaggtgcgggtggaggagtccacccaggtcggcggggaccccttccctgct
gtgtttggggacttcctgggccgggagcgcctgggctccttcggcagcatcacccggcag
caggagggcgaggccagctctcaggacatgactgcacaggtgaccagcccatcgggcaag
atggaagccgcggagatcgtcgagggcgaggacagcgcctacagtgtgcgctttgtgccc
caggagatggggccccatacggtcgctgtcaagtaccgtggccagcacgtgcccggcagc
ccctttcagttcactgtggggccgctaggtgaaggcggggcccacaaggtgcgggccgga
ggcacagggctggagcgaggtgtggccggcgtgccagccgagttcagcatctggacccgg
gaggccggtgctgggggcctgtccattgctgtggagggtcctagcaaggcggagattgca
tttgaggatcgcaaagatggctcctgcggcgtctcctatgttgtccaggaaccaggtgac
tatgaggtctccatcaagttcaatgatgagcacatcccggacagtccctttgtggtgcct
gtggcctccctctcggatgacgctcgccgtctcaccgtcaccagcctccaggagacaggg
ctcaaggtgaaccagccggcgtcctttgctgtgcagctgaacggcgcacggggcgtgatt
gatgcccgggtgcacacaccctcgggggctgtggaggagtgctacatctctgagctagac
agtgacaagcataccatccgcttcatcccccacgagaatggcgtccactccattgatgtc
aagttcaatggtgcccacatccctggaagtcccttcaagatccgcgttggggagcagagc
caggctggggacccaggcttggtgtcagcctatggtcctgggctcgagggaggcactact
ggtgtgtcatcagagttcatcgtgaacaccctgaacgccggctcgggggccttgtctgtc
accattgatggcccctccaaggtgcagctggactgtcgggagtgtcctgagggccacgtg
gtcacttacactcccatggcccctggcaactacctcattgccatcaagtacggtggcccc
cagcacatcgtgggcagccctttcaaggccaaggtcactggtccgaggctgtccggaggc
cacagccttcacgaaacatccaccgttctggtggagactgtgaccaagtcttcctcaagc
cggggctccagctacagctccatccccaagttctcctcagatgccagcaaggtggtgact
cggggccctgggctgtcccaggccttcgtaggccagaagaactccttcaccgtggactgc
agcaaagcaggcaccaacatgatgatggtgggcgtgcacggccccaagaccccctgtgag
gaggtgtacgtgaagcacatggggaaccgggtgtacaatgtcacctacaccgtcaaggag
aaaggggactacatcctcatcgtcaagtggggcgacgaaagtgtccctggaagccccttc
aaagtcaaggtcccttga

KEGG   Macaca mulatta (rhesus monkey): 702732
Entry
702732            CDS       T01028                                 

Gene name
FLNB
Definition
(RefSeq) filamin-B isoform X1
  KO
K04437  filamin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04510  Focal adhesion
mcc05132  Salmonella infection
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    702732 (FLNB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    702732 (FLNB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    702732 (FLNB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    702732 (FLNB)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     702732 (FLNB)
  Intermediate filaments
   Intermediate filament-binding proteins
    702732 (FLNB)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   702732 (FLNB)
SSDB
Motif
Pfam: Filamin CH Y_Y_Y CFSR Big_3_5 Invasin_D3
Other DBs
NCBI-GeneID: 702732
NCBI-ProteinID: XP_014986104
Ensembl: ENSMMUG00000000706
LinkDB
Position
2
AA seq 2602 aa
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
MQPGPHVVKVFFAGDTIPKSPFIVQVGEACNPNACRASGRGLQPKGVRIRETADFKVDTK
AAGSGELSVTVKGPKGLEELVKQKGFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYDDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVRAYGPGLEKSGC
IVSNLAEFTVDPKDAGKAPLKIFAQDGEGQPIDIQMKSRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPFRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDVID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGK
DQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRESSTAKFIPREEGLYAVDVTY
DGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGAKAEVSIQNNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVL
QSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQE
GKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLAT
GPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMN
GLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHI
KYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEG
PSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKL
GSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK
NGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVE
GPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESIT
RTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQ
EMGMHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTRE
AGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPDSPYLVPV
IAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEP
DKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGAGLEGGTTG
IQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLIGVKYGGPN
HIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGA
GLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGD
YVLAVKWGEEHIPGSPFHVTVP
NT seq 7809 nt   +upstreamnt  +downstreamnt
atgccggtaaccgagaaggatctggcggaggacgcgccttggaagaagatacagcagaac
actttcacacgctggtgcaatgagcacctcaagtgcgtgaacaaacgcatcggcaacctg
cagaccgacctgagcgacgggctgcggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgtaccgcaagtaccatcagcggcccacctttcgccagatgcagctcgagaatgtg
tccgtggcgctcgagttcctggaccgtgagagcatcaagctcgtgtccatcgatagcaaa
gccattgtggatgggaacctgaagctcatcttgggtctggtgtggacgctgatcctccac
tactccatctccatgcctgtgtgggaggatgaaggggatgatgatgccaagaagcagacg
ccaaagcagaggctgctggggtggattcagaacaagatcccctacttgcccatcaccaac
tttaaccagaactggcaagatggcaaagccctgggagccctggtagacagctgtgctcca
ggtctgtgcccagactgggaatcctgggacccgcagaagcctgtagataatgcacgagaa
gccatgcagcaggcagatgactggctgggtgtcccacaggtcatcactcctgaagaaatc
attcacccggatgtggacgagcactcggttatgacttacctgtcccagttccccaaagcc
aagctcaagccaggggctcctctcaaacccaaactcaacccgaagaaagccagggcctat
ggcagaggaatcgagcccactggaaacatggtgaagcagccagccaaattcactgtggac
accatcagcgccgggcaaggagacgtgatggtgtttgttgaggacccagaagggaacaaa
gaagaggcacaagtgacccctgacagcgacaagaacaagacatactctgtggagtatctg
cccaaggtcactgggctgcacaaagtcacagtcctctttgcaggacagcacatctccaag
agcccatttgaagtgaatgttgacaaggcccagggagacgccagtaaagtcactgcaaaa
ggtccagggttggaagctgtagggaacatcgccaataagcccacttactttgacatctac
acggcaggagctggtgtgggtgacattggtgtggaggtggaagatccccaggggaagaac
actgtggaattgctcgtggaagacaaaggaaaccaggtgtatcgatgtgtgtacaaaccc
atgcagcccggcccccacgtggtcaaggtcttctttgctggggacactattcctaagagt
cccttcattgtgcaggttggggaagcctgcaatccaaatgcctgccgggccagtggccga
ggcctgcaacccaagggcgtccgtatccgggagactgcagatttcaaggttgacaccaaa
gctgcaggaagtggggagctcagtgtaaccgtgaagggtcctaagggtctggaggagctg
gtgaagcagaaaggctttctggatggggtctacgcattcgagtattaccccagcaccccg
gggagatacagcattgccatcacatgggggggacaccacattccaaagagcccctttgaa
gttcaagttggccctgaagcaggtatgcagaaagtccgtgcttggggccctgggctccat
ggtgggattgtcgggcggtcggcagacttcgtggtggaatccattggctctgaagtgggg
tctctggggtttgccattgaaggcccctctcaggcaaagattgagtacgatgaccagaat
gatggatcatgtgacgtcaaatactggcccaaggagcctggcgaatatgctgttcacatc
atgtgtgacgacgaagacatcaaggatagcccgtacatggccttcatccacccagccacg
ggagactacaaccctgatctggttcgagcatatgggccaggtttggagaaatctgggtgc
attgtcagcaacctggccgagttcactgtggatcctaaggatgctggaaaagctccctta
aagatatttgctcaggatggggaaggccaacctattgacatccagatgaagagtcggatg
gacggcacatatgcttgctcatacactccggtgaaggccatcaagcataccattgctgtg
gtctggggaggcgtgaacatcccgcacagccccttcagggtcaacatcgggcaaggtagc
catcctcagaaggttaaagtgtttgggccaggagtggagagaagtggtctgaaggcaaat
gaacctacacacttcacagtggactgtactgaggctggggaaggtgatgtcagcgttggc
attaagtgtgatgcccgggtgttaagtgaagatgaggaagacgtggattttgacattatt
cacaatgccaatgatacgtttacagtcaaatatgtgcctcctgctgctgggcgatacact
atcaaagttctctttgcatctcaggaaatccccgccagccctttcagagtcaaagttgac
ccttcccacgatgccagcaaagtgaaggcagaaggcccagggctcagcaaagcaggtgtg
gaaaatgggaaaccgacccacttcactgtctacaccaagggggccgggaaagccccgctc
aacgtgcagttcaacagccctcttcctggcgatgcagtgaaggatttggatgtcatcgat
aactacgactactcccacaccgttaaatatacacccacccaacagggcaacatgcaggtt
ctggtgacttacgggggcgatcccatccctaaaagccctttcactgtgggtgttgctgca
ccgctggatctgagcaagataaaactcaatgggctggaaaacagggtggaagttgggaag
gatcaggagttcaccgttgataccaggggggcaggaggccaggggaagctggacgtgaca
atcctcagcccctctcggaaggttgtgccatgcctagtgacacctgtgacaggccgggag
agcagcacagccaagttcatccctcgggaggaggggctgtatgctgtagacgtgacctac
gatggacaccctgtgcccgggagcccctacacagtggaggcctcactgccaccagatccc
accaaggtgaaggcgcatggtcctggcctcgaaggtggtcttgtgggcaagcctgctgag
ttcaccatcgataccaaaggagctggtaccggaggtctgggcttaacggtggaaggtcca
tgcgaggccaaaatcgagtgctccgacaatggtgacgggacctgctcagtctcttacctt
cccacaaaacccggggagtacttcgtcaacatcctctttgaggaagtccacatacctggg
tctcccttcaaagccgacattgaaatgccctttgacccctctaaagtcgtggcatcaggg
ccaggtctcgagcatgggaaggtgggtgaagctgggctccttagcgtcgactgttcagaa
gcgggaccaggggccctgggcctggaagctgtctcagactcgggagcaaaagccgaagtc
agtattcagaacaacaaagatggcacctacgcggtgacctacgtgcccctgacggccggc
atgtacacactgaccatgaagtatggtggtgaactcgtaccacacttccctgcccgggtc
aaggtggagcctgccgtggacaccagcaggatcaaagtctttggaccagggatagaaggg
aaagatgtgttccgggaagccaccaccgactttacggttgactctcggccgctgacccag
gttgggggtgaccacatcaaggcccacattgccaacccctcaggggcctccaccgagtgc
tttgtcacagacaatgctgatgggacctaccaggtggaatacacaccctttgagaaaggt
ctccatgtagtggaggtgacatatgatgatgtgcctatcccaaacagtcccttcaaggtg
gctgtcactgaaggctgccaaccatctagggtacaagcccaaggacctggattgaaagag
gcctttaccaacaagcccaatgtcttcactgtggttaccagaggggcaggaattggtggg
cttggcatcactgttgagggaccatcagagtcgaagataaattgcagagacaacaaggat
ggcagctgcagtgctgagtacattcctttcgctccgggggattatgatgttaatatcaca
tatggaggagcccacatccctggcagccccttcagggttcctgtgaaggatgttgtggac
cccagcaaggtcaagattgccggccctgggctgggctcaggcgtccgagcccgtgtcctg
cagtccttcacagtggacagcagcaaggctggcctggctccgctggaagtgagggtcctg
ggcccacgaggcctggtggagccagtgaacgtggtggacaatggggatggcacacacaca
gtaacctacactccatctcaggagggaccttatatggtctcagttaaatatgctgatgaa
gagattcctcgcagtcccttcaaggtcaaggtccttcccacatatgatgccagcaaagtg
accgccagtggccccggccttagttcctatggtgtgcctgccagtctacctgtggacttt
gcaatcgatgcccgagatgccggggaaggcctgcttgctgttcagataacggaccaagaa
ggaaaacccaaaagagccattgtccatgacaataaagatggcacatatgctgtcacctac
atccccgacaagactgggcgctatatgattggggtcacctacgggggtgacgacatccca
ctttctccttatcgcatccgagccacacagacgggtgatgccagcaagtgcctggccacg
ggtcctggaatcgcctccactgtgaaaactggcgaagaagtaggctttgtggttgatgcc
aagactgccgggaaggggaaagtgacctgcacagttctgaccccagatggcactgaggcc
gaggccgatgtcatcgagaatgaagatggaacctatgacatcttctacacagctgccaag
ccaggcacatatgtgatctatgtgcgcttcggtggtgttgatattcctaacagccccttc
actgtcatggccacagatggggaagtcacagccgtggaggaggcaccggtaaatgcatgt
ccccctggattcaggccctgggtgaccgaagaggcctatgtcccagtgagtgacatgaat
ggcctgggatttaagccttttgacctggtcattccgtttgctgtcaggaaaggagaaatc
actggggaggtacacatgccttctgggaagacggccacacctgagattgtggacaacaag
gacggcacggtgactgttcgatacgcccccactgaagttgggctccacgagatgcacatc
aaatacatgggcagccacatccctgagagcccactccagttctatgtgaactaccccaac
agtggaagcgtttctgcatatggtccaggcctcgtgtatggagtggccaacaaaactgcc
accttcaccatcgtcacagaggatgcaggagaaggtggtctggacttggctattgagggc
ccctcaaaagcagaaatcagctgcattgacaataaagatgggacatgcacagtgacctac
ctgcccactctgccaggcgactacagcattctggtcaagtacaatgacaagcacatccct
ggcagccccttcacagccaagatcacagatgacagcaggcggtgctcccaggtgaagttg
ggctcggccgctgacttcctgcttgacatcagtgagactgacctcagcagcctgacggcc
agcattaaggccccatctggccgagatgagccctgtctcctgaagaggctgcccaacaac
cacattggcatctccttcatcccccgggaagtgggtgaacacctggtcagcatcaagaaa
aatggcaaccacgtggccaacagccccgtgtccatcatggtggtccagtccgagatcggt
gacgcccgccgagccaaagtctatggccgtggcctgtcagaaggccggactttcgagatg
tctgacttcatcgtggacacaagggatgcaggttatggtggcatatccttggcagtggaa
ggccccagcaaagtagacatccagacagaggacctggaagatggcacctgcaaagtctcc
tacttccccactgtgcctggggtttatatcgtctccaccaaatttgctgatgagcacgtg
cctgggagcccatttaccgtgaagatcagcggtgagggaagagtcaaagagagcatcacc
cgcaccagtcgggccccgtccgtggccactgtcgggagcatttgtgacctgaacctgaaa
atcccagaaatcaacagcagtgatatgtcggcccacgtcaccagcccctctggccgtgtg
actgaagcggagattgtacccatggggaagaactcgcactgcgtccggtttgtgccccag
gagatgggcatgcacacggtcagcgtcaagtaccgcgggcagcacgtcactggcagcccc
ttccagttcaccgtggggccacttggtgaaggaggtgcccacaaggtgcgggcaggaggc
cctggcctggagagaggagaagcgggagtcccagctgagttcagcatttggacccgggaa
gcaggtgctggaggcctctccatcgctgttgagggccccagtaaggctgagattacattc
gatgaccataaaaatgggtcgtgcggtgtgtcttatattgcccaagagcctggtaactac
gaggtgtccatcaagttcaatgatgagcacattccggacagcccctacctggtgccggtc
atcgcgccctctgacgacgcccgccgcctcactgttatgagccttcaggaatcgggatta
aaagttaaccagccagcatcctttgctataaggttgaatggcgcaaaaggcaagattgat
gcaaaggtgcacagcccctctggagccgtggaggagtgccacgtgtctgagctggagcca
gataagtacgctgttcgcttcatccctcatgagaatggtgttcacaccatcgatgtcaag
ttcaatgggagccacgtggttggaagccccttcaaagtgcgcgttggggagcccggacaa
gcggggaaccctgccctggtgtccgcctatggcgcaggactcgaagggggcaccacaggt
atccagtcggaattctttattaacaccacccgagcaggtccggggacactatccgtcacc
atcgaaggcccgtccaaggttaaaatggattgccaggaaacacctgaagggtacaaagtc
atgtacacccccatggctcctggtaactacctgatcggcgtcaaatacggtgggcccaac
cacattgtgggcagtcccttcaaggccaaggtgacaggccagcgtctggttagccccggc
tcagccaatgagacctcgtccatcctggtggagtcagtgaccaggtcttctacagagacc
tgctatagcgccattcccaaggcatcctcagacgccagcaaggtgacctctaagggggca
gggctctcgaaggcctttgtgggccagaagagttccttcctggtggactgcagcaaagct
ggctccaacatgctgctgatcggggtccatgggcccaccaccccctgcgaggaggtctct
atgaagcatgtaggcaaccagcaatacaacgtcacatatgtcgtcaaggagcggggcgat
tatgtgctggctgtgaagtggggggaggaacacatccctggcagcccttttcatgtcaca
gtgccttaa

DBGET integrated database retrieval system