KEGG   Macaca mulatta (rhesus monkey): 699568
Entry
699568            CDS       T01028                                 

Gene name
HSP90B1
Definition
(RefSeq) endoplasmin precursor
  KO
K09487  heat shock protein 90kDa beta
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04141  Protein processing in endoplasmic reticulum
mcc04151  PI3K-Akt signaling pathway
mcc04657  IL-17 signaling pathway
mcc04915  Estrogen signaling pathway
mcc04918  Thyroid hormone synthesis
mcc05132  Salmonella infection
mcc05200  Pathways in cancer
mcc05215  Prostate cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    699568 (HSP90B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    699568 (HSP90B1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    699568 (HSP90B1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    699568 (HSP90B1)
   04918 Thyroid hormone synthesis
    699568 (HSP90B1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    699568 (HSP90B1)
  09162 Cancer: specific types
   05215 Prostate cancer
    699568 (HSP90B1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    699568 (HSP90B1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    699568 (HSP90B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mcc03110]
    699568 (HSP90B1)
Chaperones and folding catalysts [BR:mcc03110]
 Heat shock proteins
  HSP90
   699568 (HSP90B1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 MH1 DUF4518
Other DBs
NCBI-GeneID: 699568
NCBI-ProteinID: NP_001182453
Ensembl: ENSMMUG00000023469
UniProt: I0FUR4 Q3YAP0
LinkDB
Position
11
AA seq 804 aa
MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNT
LGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAK
EEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYK
SFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD
DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKY
NDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYF
MAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDE
SEKTKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMER
IMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVLFET
ATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEDEPEEEPEETTEDTTEDTEQDEDE
EMDVGTDEEEQETAKESTAEKDEL
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgagggccctgtgggtgctgggcctctgctgcgtcctgctgaccttcgggtcggtcaga
gctgacgacgaagttgatgtggatggtacagtagaagaggatctgggtaaaagtagagaa
ggctcaaggacggatgatgaagtagtacagagagaggaagaagctattcagttggatgga
ttaaatgcatcgcaaataagagaacttagagagaagtcggaaaagtttgcctttcaagct
gaagttaacagaatgatgaaacttatcatcaattcattgtataaaaataaagagattttc
ctgagagaactgatttcaaatgcttccgacgctttagataagatacggctaatatcactg
actgatgaaaatgctctttctggaaatgaggaactaacagttaaaattaagtgtgataag
gagaagaacctgctgcatgtcacagacaccggtgtaggaatgaccagagaagagttggtt
aagaaccttggtaccatagccaaatctggaacaagcgagtttttaaacaagatgacggaa
gcacaggaagatggccagtcaacttctgaattgattggccagtttggtgttggtttctat
tccgccttccttgtagcagataaggttattgtcacatcaaaacacaacaacgatacccag
cacatctgggagtccgactccaatgaattttcagtaattgctgacccaagaggaaacact
ctaggacggggaacgacaattacccttgtcttaaaagaagaagcatctgattaccttgaa
ttggatacaattaaaaatctcgtcaaaaaatattcacagttcataaactttcctatttat
gtatggagcagcaagactgaaactgttgaggagcccatggaggaagaagaagcagcaaaa
gaagagaaagaagaatctgatgatgaagctgcagtagaggaagaagaagaagaaaagaaa
ccaaaaactaaaaaagttgaaaaaactgtctgggactgggaacttatgaatgatatcaaa
ccaatatggcagagaccatcaaaagaagtagaagaagatgaatacaaagctttctacaaa
tcattttcaaaggaaagtgatgaccccatggcttacattcactttaccgctgaaggggaa
gttaccttcaaatcaattttatttgtacccacatctgctccacgtggtctgtttgacgaa
tatggatctaaaaagagtgattacattaagctctatgtgcgccgtgtattcatcacagac
gacttccatgatatgatgcctaagtaccttaattttgtcaagggtgtggtggactcagat
gatctgcccttgaatgtttcccgcgagactcttcagcaacataaactgcttaaggtaatt
aggaagaagcttgttcgtaaaacgctggacatgatcaagaagattgctgatgataaatac
aatgatactttttggaaagaatttggtaccaacatcaagcttggtgtgattgaagaccac
tcgaatcgaacacgtcttgctaaacttcttaggttccagtcttctcatcatccaactgac
attactagcctagaccaatatgtagaaagaatgaaggaaaaacaagacaaaatctacttc
atggctgggtccagcagaaaagaggctgaatcttctccatttgttgagcgacttctgaaa
aagggctatgaagttatttacctcacagaacctgtggatgaatactgcattcaggccctt
cctgaatttgatgggaagaggttccagaatgttgccaaggaaggagtgaagtttgatgaa
agtgaaaaaactaaggagagtcgtgaagcagttgagaaagaatttgaacctctgctgaac
tggatgaaagataaagcccttaaggacaagattgaaaaggctgtggtgtctcagcgtctg
acagaatctccatgtgctttggtggccagccagtatggatggtctggcaacatggagaga
atcatgaaagcacaagcgtaccaaacaggcaaggacatctctacaaattactatgcgagt
cagaagaaaacatttgaaattaatcccagacacccgctgatcagagacatgcttcgacga
attaaggaagatgaagatgataaaacagttttggatcttgctgtggttttgtttgaaaca
gcaacgcttcggtcaggatatcttttaccagacactaaagcatatggagatagaatagaa
agaatgcttcgcctcagtttgaacattgaccctgatgcaaaggtggaagatgagcccgaa
gaagaacctgaagagacaacagaagacacgacagaagacacagagcaagacgaagatgaa
gaaatggatgtgggaacagatgaagaagaacaagaaacagcaaaggaatctacagctgaa
aaagatgaattgtaa

KEGG   Macaca mulatta (rhesus monkey): 702293
Entry
702293            CDS       T01028                                 

Gene name
HSP90AB1
Definition
(RefSeq) heat shock protein HSP 90-beta
  KO
K04079  molecular chaperone HtpG
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04141  Protein processing in endoplasmic reticulum
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04612  Antigen processing and presentation
mcc04621  NOD-like receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04659  Th17 cell differentiation
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc05132  Salmonella infection
mcc05200  Pathways in cancer
mcc05215  Prostate cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    702293 (HSP90AB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    702293 (HSP90AB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    702293 (HSP90AB1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    702293 (HSP90AB1)
   04612 Antigen processing and presentation
    702293 (HSP90AB1)
   04659 Th17 cell differentiation
    702293 (HSP90AB1)
   04657 IL-17 signaling pathway
    702293 (HSP90AB1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    702293 (HSP90AB1)
   04914 Progesterone-mediated oocyte maturation
    702293 (HSP90AB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    702293 (HSP90AB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    702293 (HSP90AB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    702293 (HSP90AB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    702293 (HSP90AB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    702293 (HSP90AB1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mcc03110]
    702293 (HSP90AB1)
   04131 Membrane trafficking [BR:mcc04131]
    702293 (HSP90AB1)
   03051 Proteasome [BR:mcc03051]
    702293 (HSP90AB1)
   03029 Mitochondrial biogenesis [BR:mcc03029]
    702293 (HSP90AB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    702293 (HSP90AB1)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     702293 (HSP90AB1)
Chaperones and folding catalysts [BR:mcc03110]
 Heat shock proteins
  HSP90
   702293 (HSP90AB1)
Membrane trafficking [BR:mcc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    702293 (HSP90AB1)
Proteasome [BR:mcc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    702293 (HSP90AB1)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    702293 (HSP90AB1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   702293 (HSP90AB1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 702293
NCBI-ProteinID: NP_001182462
Ensembl: ENSMMUG00000022686
UniProt: F7GST0
LinkDB
Position
4
AA seq 724 aa
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPSAAVPDEIPPLEGDEDASRM
EEVD
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgcctgaggaagtgcaccatggagaggaggaggtggagacttttgcctttcaggcagaa
attgcccaactcatgtccctcatcatcaataccttctattccaacaaggagattttcctt
cgggagttgatctctaatgcttctgatgccttggacaagattcgctatgagagcttaaca
gacccttcgaagttggacagtggtaaagagctgaaaattgacatcatccccaaccctcag
gaacgtaccctgactttggtagacacaggcattgggatgaccaaagctgatctcataaat
aatttgggaaccattgccaagtctggtactaaagcatttatggaggctcttcaggctggt
gcagacatctccatgattggacagtttggtgttggcttttattctgcctacctggtggca
gagaaagtggttgtgatcacaaagcacaacgatgatgaacagtatgcttgggagtcttct
gctggaggttccttcactgtgcgggctgaccatggtgagcccattggcagaggtaccaaa
gtgatcctccatcttaaagaagatcagacagagtacttggaagagaggcgggtcaaagaa
gtagtgaagaagcactctcagttcataggctatcccatcaccctttatttggagaaggag
cgagagaaggaaattagtgatgatgaggcagaggaagagaaaggtgagaaagaagaggaa
gataaagatgatgaagaaaagcccaagatcgaagatgtgggttcagatgaggaggatgac
agtggtaaggataagaagaagaaaactaagaagatcaaagagaaatacattgatcaggaa
gagctaaacaagaccaagcctatttggaccagaaaccctgatgacatcacccaagaggag
tatggagaattctataagagcctcaccaatgactgggaagaccacttggcagtcaagcac
ttttctgtagaaggtcagttggaattcagggcattgctattcattcctcgtcgggctccc
tttgacctttttgagaacaagaagaaaaagaacaacatcaaactctatgtccgtcgtgtg
ttcatcatggacagctgtgatgagttaataccagagtatctcaattttattcgtggtgtg
gttgactctgaggatctgcccctgaacatctcccgagaaatgctccagcagagcaaaatc
ttgaaagtcattcgtaaaaacattgttaagaagtgtcttgagctcttctctgagctggca
gaagacaaggagaattacaagaaattctatgaggcattctctaaaaatctcaagcttgga
atccacgaggactccactaaccgccgccgcctgtctgagctgctgcgctatcacacctcc
cagtctggagatgagatgacatctctgtcagagtatgtttctcgcatgaaggagacacag
aagtccatctattacatcactggtgagagcaaagagcaggtggccaactcagcttttgtg
gagcgagtgcggaaacggggcttcgaggtggtatatatgaccgagcccattgacgagtac
tgtgtgcagcagctcaaggagtttgatgggaagagcctggtctcagttaccaaggagggt
ctggagctgcctgaggatgaggaggagaagaagaagatggaagagagcaaggcaaagttt
gagaacctttgcaagctcatgaaagaaatcttagataagaaggttgagaaggtgacaatt
tccaataggcttgtgtcttcaccctgctgcattgtgaccagcacctatggctggacagcc
aatatggagcggatcatgaaagcccaggcacttcgggacaactccaccatgggctatatg
atggccaaaaagcacctggagatcaaccctgaccaccccattgtggagactctgcggcag
aaggctgaggccgacaagaatgataaggcagttaaggacctggtggtgctgctgtttgaa
accgccctgctctcttcaggcttttcccttgaggatccccagacccactccaaccgcatc
taccgcatgatcaagctaggtctaggtattgatgaagatgaagtggcagcagaagaaccc
agtgctgcagttcctgatgagattccccctcttgagggcgatgaggatgcgtctcgcatg
gaagaagtcgattag

KEGG   Macaca mulatta (rhesus monkey): 708431
Entry
708431            CDS       T01028                                 

Gene name
HSP90AA1
Definition
(RefSeq) heat shock protein 90kDa alpha (cytosolic), class A member 1
  KO
K04079  molecular chaperone HtpG
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04141  Protein processing in endoplasmic reticulum
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04612  Antigen processing and presentation
mcc04621  NOD-like receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04659  Th17 cell differentiation
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc05132  Salmonella infection
mcc05200  Pathways in cancer
mcc05215  Prostate cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    708431 (HSP90AA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    708431 (HSP90AA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    708431 (HSP90AA1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    708431 (HSP90AA1)
   04612 Antigen processing and presentation
    708431 (HSP90AA1)
   04659 Th17 cell differentiation
    708431 (HSP90AA1)
   04657 IL-17 signaling pathway
    708431 (HSP90AA1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    708431 (HSP90AA1)
   04914 Progesterone-mediated oocyte maturation
    708431 (HSP90AA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    708431 (HSP90AA1)
  09162 Cancer: specific types
   05215 Prostate cancer
    708431 (HSP90AA1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    708431 (HSP90AA1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    708431 (HSP90AA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    708431 (HSP90AA1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mcc03110]
    708431 (HSP90AA1)
   04131 Membrane trafficking [BR:mcc04131]
    708431 (HSP90AA1)
   03051 Proteasome [BR:mcc03051]
    708431 (HSP90AA1)
   03029 Mitochondrial biogenesis [BR:mcc03029]
    708431 (HSP90AA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    708431 (HSP90AA1)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     708431 (HSP90AA1)
Chaperones and folding catalysts [BR:mcc03110]
 Heat shock proteins
  HSP90
   708431 (HSP90AA1)
Membrane trafficking [BR:mcc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    708431 (HSP90AA1)
Proteasome [BR:mcc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    708431 (HSP90AA1)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    708431 (HSP90AA1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   708431 (HSP90AA1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 Zip LOH1CR12
Other DBs
NCBI-GeneID: 708431
NCBI-ProteinID: NP_001182596
UniProt: A0A5F8ARZ4
LinkDB
AA seq 733 aa
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKED
KEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTR
NPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKN
NIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKK
CLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKD
YCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGK
TLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCI
VTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSV
KDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPL
EGDDDTSRMEEVD
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgcctgaggaaacgcagacccaggaccaaccgatggaggaggaggaggttgagacgttc
gcctttcaggcagaaattgcccagttgatgtcattgattatcaatactttttattcgaac
aaagagatctttctaagagagctaatttcaaattcatcagatgcattggacaaaatccgc
tatgagagcttgacggatcccagtaaattagactctgggaaagagctgcatattaacctg
ataccaaataaacaagatcgaaccctcactattgtggatactggaattgggatgaccaag
gctgacttgatcaataaccttggtactatcgccaagtctgggaccaaagcgttcatggaa
gctttgcaggctggtgcagatatctccatgattggccagttcggtgttggtttttattct
gcttatttggttgctgagaaagtaactgtgatcaccaaacataacgatgatgagcagtac
gcctgggagtcctcagcagggggatcatttacagtgaggacagacacaggtgaacctatg
ggtcgtggaacaaaggttatcctacacctgaaagaagaccaaactgagtacttggaggaa
cgaagaataaaggagattgtgaagaaacattctcagtttattggatatcccattactctt
tttgtggagaaggaacgtgataaagaagtcagcgatgatgaggctgaagaaaaagaagac
aaagaagaagaaaaagaaaaagaagagaaagagtctgaagacaaacctgaaattgaagat
gttggttctgatgaggaagaagaagaaaagaaggatggtgacaagaagaagaaaaagaag
attaaggagaagtacatcgatcaagaagaactcaacaaaacaaagcccatctggaccaga
aatcccgacgatattactaatgaggagtatggagaattctacaagagcttgaccaatgac
tgggaagatcacttggcagtgaagcatttttcagttgaagggcagttggaattcagagcc
cttctatttgtcccacgacgtgctccttttgacctgtttgaaaacagaaagaaaaagaac
aacatcaaattgtatgtacgcagagttttcatcatggataactgtgaggagctaatccct
gaatatctgaacttcattagaggggtggtagactcagaggatctccctctaaatatatcc
cgtgagatgttgcagcaaagcaaaattttgaaagttatcaggaagaatttggtcaaaaaa
tgcttagaactctttactgaactggcggaagataaagagaactacaagaagttctatgag
cagttctctaaaaacataaagcttggaatacatgaagactcacaaaatcggaagaagctt
tcagagctgttaaggtactacacatctgcctctggcgatgagatggtttctctcaaggat
tactgcaccagaatgaaggaaaaccagaaacatatctattatatcacaggtgagaccaag
gaccaggtagctaactcagcctttgtggaacgtcttcggaaacatggcttagaagtgatc
tatatgatcgagcccattgatgagtactgtgtccaacagctaaaagaatttgaggggaag
acattagtgtcagtcaccaaagagggcttggaacttccagaggatgaagaagagaaaaag
aaacaggaagagaaaaaaacaaagtttgagaacctctgcaaaatcatgaaagacatactg
gagaaaaaagttgaaaaggtggttgtgtcaaaccgattggtgacgtctccatgctgtatt
gtcacaagcacatatggctggacagcaaacatggagagaatcatgaaagctcaagcccta
agagacaactcaacaatgggttacatggcagcaaagaaacacctggagataaaccctgac
cattccattattgagaccttaaggcaaaaggcagaggctgataagaacgacaagtctgtg
aaggatctggtcatcttgctttacgaaactgcactcctgtcttctggcttcagtctggaa
gatccccagacacatgccaacaggatctacaggatgatcaaacttggtctgggtatcgat
gaagatgatcctactgctgatgataccagtgcagctgtaactgaagaaatgccgcccctc
gaaggagatgacgacacatcacgcatggaagaagtagactaa

DBGET integrated database retrieval system