KEGG   Macaca mulatta (rhesus monkey): 699578
Entry
699578            CDS       T01028                                 

Gene name
IRF7
Definition
(RefSeq) interferon regulatory factor 7
  KO
K09447  interferon regulatory factor 7
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05164  Influenza A
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    699578 (IRF7)
   04621 NOD-like receptor signaling pathway
    699578 (IRF7)
   04622 RIG-I-like receptor signaling pathway
    699578 (IRF7)
   04623 Cytosolic DNA-sensing pathway
    699578 (IRF7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    699578 (IRF7)
  09172 Infectious disease: viral
   05161 Hepatitis B
    699578 (IRF7)
   05160 Hepatitis C
    699578 (IRF7)
   05164 Influenza A
    699578 (IRF7)
   05162 Measles
    699578 (IRF7)
   05168 Herpes simplex virus 1 infection
    699578 (IRF7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    699578 (IRF7)
   05169 Epstein-Barr virus infection
    699578 (IRF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    699578 (IRF7)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    699578 (IRF7)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 699578
NCBI-ProteinID: NP_001129572
Ensembl: ENSMMUG00000004014
UniProt: B6CJX4
LinkDB
Position
14
AA seq 504 aa
MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIF
KAWAVARGRWPPSSRGGDPPPPEAEAAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPH
KVYALSPELGWREGPGTDQTEAEGPAAVRPPQGRPPGPFLAHRDAGLQAPGPFPAPAGDK
GDLLLQAVQQSCLADHLLTASWGADPVPAQAPGEGQEGLPLTGACAGGPGLPAGELCTWA
VEATPSPGPQPTALMTGEATAPEPPHQAEPYLAPSPSACTVVQEPSPGALDVTIMYKGRT
VLQKVVGHPSCMFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLQL
ELRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRA
RQRRGSPCYTIYLGFGQDLSARRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLS
LCLSSTNSLYDDIECLLMELEQPV
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggccttggctcctgagagggcggccccacgcgtgctgttcggagagtggctccttgga
gagatcagcagcggctgctatgaggggctgcagtggctggacgaggcccgcacctgcttc
cgcgtgccctggaagcacttcgcgcgcaaggacctgagcgaggctgacgcgcgcatcttc
aaggcctgggccgtggcccgcggcaggtggccgcctagcagcagaggaggtgacccgccg
ccccccgaggctgaggctgcggagcgcgccggctggaaaaccaacttccgctgcgcactg
cgcagcacgcgccgcttcgtgatgctgcgagataactcgggggacccggccgacccgcac
aaggtgtacgcgctgagcccggagctgggctggcgagaaggcccaggcacggaccagact
gaggcagagggccccgcggctgtccggccaccgcagggcaggcccccagggccattcctg
gcacacagagatgctggactccaagccccaggccccttccctgccccagctggtgacaag
ggggacctcctgctccaggcagtgcagcagagctgcctggcggaccatctgctgacagcg
tcatggggggcagacccagtcccagcccaggctcctggagagggacaagagggtcttccc
ctgactggggcctgtgctggaggtccagggctccctgctggggagctgtgcacatgggca
gtagaagcaacccctagccccgggccccagcccacggcgctaatgacaggcgaggccacg
gccccagagcccccgcaccaggcagagccatacctggcaccctccccaagtgcctgcact
gtggtgcaagagcccagcccaggggcgctggacgtgaccatcatgtacaagggccgcaca
gtgctgcagaaggtggtggggcacccgagctgcatgttcctgtacggccccccagaccca
gctgtccgggccacagacccccagcaggtagcattccccagccctgctgagctccccgac
cagaagcagctgcgctacacggaggaactgctgaggcacgtggcccctgggctgcagctg
gagcttcgggggccacagctgtgggcccggcgcatgggcaagtgcaaggtgtactgggag
gtgggtggccccccgggctccgccagcccctccaccccagcctgcctgctgcctcggaac
tgcgacacccccatctttgacttcagagtcttcttccaagagctggtggaattccgcgca
cggcagcgccgcggctccccctgctataccatctacctgggcttcgggcaggacctgtca
gccaggaggcccaaggagaagagcctggtcctggtgaagctggagccctggctgtgccga
gtgcacctggagggcacgcaacgtgagggtgtgtcttccctggatagcagcagcctcagc
ctctgtctgtccagcaccaacagcctctatgatgacattgagtgcttgctcatggagctg
gagcagcccgtctag

DBGET integrated database retrieval system