KEGG   Macaca mulatta (rhesus monkey): 699728Help
Entry
699728            CDS       T01028                                 

Gene name
GCK
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00010  Glycolysis / Gluconeogenesis
mcc00052  Galactose metabolism
mcc00500  Starch and sucrose metabolism
mcc00520  Amino sugar and nucleotide sugar metabolism
mcc00524  Neomycin, kanamycin and gentamicin biosynthesis
mcc01100  Metabolic pathways
mcc01200  Carbon metabolism
mcc04910  Insulin signaling pathway
mcc04911  Insulin secretion
mcc04917  Prolactin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04930  Type II diabetes mellitus
mcc04950  Maturity onset diabetes of the young
mcc05230  Central carbon metabolism in cancer
Module
mcc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    699728 (GCK)
   00052 Galactose metabolism
    699728 (GCK)
   00500 Starch and sucrose metabolism
    699728 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    699728 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    699728 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    699728 (GCK)
   04910 Insulin signaling pathway
    699728 (GCK)
   04922 Glucagon signaling pathway
    699728 (GCK)
   04917 Prolactin signaling pathway
    699728 (GCK)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    699728 (GCK)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    699728 (GCK)
   04950 Maturity onset diabetes of the young
    699728 (GCK)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     699728 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 699728
NCBI-ProteinID: XP_001092919
Ensembl: ENSMMUG00000002427
UniProt: F6PLG6
LinkDB All DBs
Position
3
AA seq 466 aa AA seqDB search
MAMDATRSQAQTALTLVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLP
TYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTA
EMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGN
NVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQ
NVELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKLIGGKYMG
ELVRLVLLRLVDENLLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQIYNILSTLGLRP
SATDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSF
KERFHASVRRLTPSCEITFIESEEGSGRGAALVSAVACKKACMLGQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggatgccacaaggagccaggcccagacagccttgactctggtagagcagatc
ctggcggagttccagctgcaggaggaggacctgaagaaggtgatgagacggatgcagaag
gagatggaccgtggcctgaggttggagacccatgaagaggccagtgtgaagatgctgccc
acctacgtgcgctccaccccagaaggctcagaagtcggggacttcctctccctggacctg
ggtggcaccaacttcagggtgatgctggtgaaggtgggagaaggtgaggaggggcagtgg
agcgtgaagaccaaacaccagatgtactccatccccgaggacgccatgaccggcactgct
gagatgctcttcgactacatctccgagtgcatctccgacttcctggacaagcatcagatg
aagcacaagaagctgcccctgggcttcaccttctcctttcctgtgaggcatgaagacatc
gataagggcatccttctcaactggaccaagggcttcaaggcctcaggagcagaagggaac
aatgtcgtggggcttctgcgagatgccatcaaacggagaggggacttcgaaatggatgtg
gtggcaatggtgaatgacacggtggccacgatgatctcctgctactacgaagaccatcag
tgcgaggtcggcatgattgtgggcacgggctgcaacgcctgctacatggaggagatgcag
aatgtggagctggtggagggggacgagggccgcatgtgcgtcaacaccgaatggggcgcc
ttcggggactcgggcgagctggacgagttcctgctggagtatgaccgcctggtggacgag
agctctgcaaaccccggtcagcagctgtatgagaagctcataggtggcaagtacatgggc
gagctggtgcggctcgtgctgctcaggctcgtggacgaaaacctgctcttccacggggag
gcctccgagcagctgcgcacacgcggagccttcgagacacgcttcgtgtcgcaggtggag
agcgacacgggcgaccgcaagcagatctacaacatcctgagcacgctggggctacgaccc
tcggccactgactgcgacatcgtgcgccgcgcctgcgagagcgtgtctacgcgcgctgca
cacatgtgctcggcggggctggcgggcgtcatcaaccgcatgcgcgagagccgcagcgag
gacgtaatgcgcatcactgtgggcgtggatggctccgtgtacaagctgcaccccagcttc
aaggagcggttccacgctagcgtgcgcaggctgacgcccagctgcgagatcaccttcatc
gagtcggaggagggcagtggccggggcgcggccctggtctcggcggtggcctgtaagaag
gcctgcatgctgggccagtga

DBGET integrated database retrieval system