KEGG   Macaca mulatta (rhesus monkey): 699736
Entry
699736            CDS       T01028                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform 1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04024  cAMP signaling pathway
mcc04068  FoxO signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04137  Mitophagy - animal
mcc04140  Autophagy - animal
mcc04141  Protein processing in endoplasmic reticulum
mcc04210  Apoptosis
mcc04215  Apoptosis - multiple species
mcc04217  Necroptosis
mcc04310  Wnt signaling pathway
mcc04380  Osteoclast differentiation
mcc04510  Focal adhesion
mcc04530  Tight junction
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04668  TNF signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc04723  Retrograde endocannabinoid signaling
mcc04728  Dopaminergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04910  Insulin signaling pathway
mcc04912  GnRH signaling pathway
mcc04914  Progesterone-mediated oocyte maturation
mcc04917  Prolactin signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04926  Relaxin signaling pathway
mcc04930  Type II diabetes mellitus
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc05010  Alzheimer disease
mcc05012  Parkinson disease
mcc05016  Huntington disease
mcc05017  Spinocerebellar ataxia
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05132  Salmonella infection
mcc05133  Pertussis
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05161  Hepatitis B
mcc05162  Measles
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05231  Choline metabolism in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    699736 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    699736 (MAPK10)
   04012 ErbB signaling pathway
    699736 (MAPK10)
   04014 Ras signaling pathway
    699736 (MAPK10)
   04310 Wnt signaling pathway
    699736 (MAPK10)
   04668 TNF signaling pathway
    699736 (MAPK10)
   04068 FoxO signaling pathway
    699736 (MAPK10)
   04071 Sphingolipid signaling pathway
    699736 (MAPK10)
   04024 cAMP signaling pathway
    699736 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    699736 (MAPK10)
   04137 Mitophagy - animal
    699736 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    699736 (MAPK10)
   04215 Apoptosis - multiple species
    699736 (MAPK10)
   04217 Necroptosis
    699736 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    699736 (MAPK10)
   04530 Tight junction
    699736 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    699736 (MAPK10)
   04621 NOD-like receptor signaling pathway
    699736 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    699736 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    699736 (MAPK10)
   04660 T cell receptor signaling pathway
    699736 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    699736 (MAPK10)
   04659 Th17 cell differentiation
    699736 (MAPK10)
   04657 IL-17 signaling pathway
    699736 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    699736 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    699736 (MAPK10)
   04920 Adipocytokine signaling pathway
    699736 (MAPK10)
   04912 GnRH signaling pathway
    699736 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    699736 (MAPK10)
   04917 Prolactin signaling pathway
    699736 (MAPK10)
   04926 Relaxin signaling pathway
    699736 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    699736 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    699736 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    699736 (MAPK10)
   04722 Neurotrophin signaling pathway
    699736 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    699736 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    699736 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    699736 (MAPK10)
   05231 Choline metabolism in cancer
    699736 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    699736 (MAPK10)
   05212 Pancreatic cancer
    699736 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    699736 (MAPK10)
   05012 Parkinson disease
    699736 (MAPK10)
   05016 Huntington disease
    699736 (MAPK10)
   05017 Spinocerebellar ataxia
    699736 (MAPK10)
   05020 Prion disease
    699736 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    699736 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    699736 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    699736 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    699736 (MAPK10)
   04931 Insulin resistance
    699736 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    699736 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    699736 (MAPK10)
   05135 Yersinia infection
    699736 (MAPK10)
   05133 Pertussis
    699736 (MAPK10)
   05152 Tuberculosis
    699736 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    699736 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    699736 (MAPK10)
   05161 Hepatitis B
    699736 (MAPK10)
   05171 Coronavirus disease - COVID-19
    699736 (MAPK10)
   05162 Measles
    699736 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    699736 (MAPK10)
   05169 Epstein-Barr virus infection
    699736 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    699736 (MAPK10)
   05142 Chagas disease
    699736 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    699736 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    699736 (MAPK10)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     699736 (MAPK10)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   699736 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 699736
NCBI-ProteinID: NP_001247786
Ensembl: ENSMMUG00000008342
UniProt: A0A1D5QMC7 G7MTC3
LinkDB
Position
5
AA seq 464 aa
MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttcttatactactgcagtgaaccaacattggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccaattctacagtgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatctaaagcctattggctctggggctcagggcatagtttgtgcc
gcgtatgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacccatgccaagagagcgtaccgggagctggtcctcatgaagtgtgtgaaccat
aaaaacattattagtttattaaatgtcttcacaccccagaaaacgctggaggagttccaa
gatgtttacttagtaatggaactgatggatgccaacttatgtcaagtgattcagatggaa
ttagaccacgagcgaatgtcttacctgctgtaccaaatgctgtgtggcattaagcacctc
cactctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat
tgcacattgaaaatcctggactttggactggccaggacagcaggcacaagcttcatgatg
actccatatgtggtgacacgttattacagagccccggaggtcatcctggggatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggactatattgaccagtggaataaggtaattgaacaactagga
acaccatgtccagaattcatgaagaaattgcaacccacagtaagaaactatgtggagaat
cggcccaagtatgcgggactcaccttccccaagctcttcccagattccctcttcccagcg
gactccgagcacaataaactcaaagccagccaagccagggacttgttgtcaaagatgcta
gtgattgacccagcaaaaagaatatcagtggacgacgccttacagcatccctacatcaac
gtctggtatgacccagctgaagtggaggcgcctccacctcagatatatgacaagcagttg
gatgaaagagaacacacaatcgaagaatggaaagaacttatctacaaggaagtaatgaac
tcagaagagaagactaaaaatggcgtagtaaaaggacagccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccatcctcgtctgtcaatgacatctcctccatgtcc
accgaccagaccctggcatctgacactgacagcagcctggaagcttcggcaggacccctg
ggttgttgcaggtga

KEGG   Macaca mulatta (rhesus monkey): 711115
Entry
711115            CDS       T01028                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04024  cAMP signaling pathway
mcc04068  FoxO signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04137  Mitophagy - animal
mcc04140  Autophagy - animal
mcc04141  Protein processing in endoplasmic reticulum
mcc04210  Apoptosis
mcc04215  Apoptosis - multiple species
mcc04217  Necroptosis
mcc04310  Wnt signaling pathway
mcc04380  Osteoclast differentiation
mcc04510  Focal adhesion
mcc04530  Tight junction
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04668  TNF signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc04723  Retrograde endocannabinoid signaling
mcc04728  Dopaminergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04910  Insulin signaling pathway
mcc04912  GnRH signaling pathway
mcc04914  Progesterone-mediated oocyte maturation
mcc04917  Prolactin signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04926  Relaxin signaling pathway
mcc04930  Type II diabetes mellitus
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc05010  Alzheimer disease
mcc05012  Parkinson disease
mcc05016  Huntington disease
mcc05017  Spinocerebellar ataxia
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05132  Salmonella infection
mcc05133  Pertussis
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05161  Hepatitis B
mcc05162  Measles
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05231  Choline metabolism in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    711115 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    711115 (MAPK8)
   04012 ErbB signaling pathway
    711115 (MAPK8)
   04014 Ras signaling pathway
    711115 (MAPK8)
   04310 Wnt signaling pathway
    711115 (MAPK8)
   04668 TNF signaling pathway
    711115 (MAPK8)
   04068 FoxO signaling pathway
    711115 (MAPK8)
   04071 Sphingolipid signaling pathway
    711115 (MAPK8)
   04024 cAMP signaling pathway
    711115 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    711115 (MAPK8)
   04137 Mitophagy - animal
    711115 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    711115 (MAPK8)
   04215 Apoptosis - multiple species
    711115 (MAPK8)
   04217 Necroptosis
    711115 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    711115 (MAPK8)
   04530 Tight junction
    711115 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    711115 (MAPK8)
   04621 NOD-like receptor signaling pathway
    711115 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    711115 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    711115 (MAPK8)
   04660 T cell receptor signaling pathway
    711115 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    711115 (MAPK8)
   04659 Th17 cell differentiation
    711115 (MAPK8)
   04657 IL-17 signaling pathway
    711115 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    711115 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    711115 (MAPK8)
   04920 Adipocytokine signaling pathway
    711115 (MAPK8)
   04912 GnRH signaling pathway
    711115 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    711115 (MAPK8)
   04917 Prolactin signaling pathway
    711115 (MAPK8)
   04926 Relaxin signaling pathway
    711115 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    711115 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    711115 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    711115 (MAPK8)
   04722 Neurotrophin signaling pathway
    711115 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    711115 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    711115 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    711115 (MAPK8)
   05231 Choline metabolism in cancer
    711115 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    711115 (MAPK8)
   05212 Pancreatic cancer
    711115 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    711115 (MAPK8)
   05012 Parkinson disease
    711115 (MAPK8)
   05016 Huntington disease
    711115 (MAPK8)
   05017 Spinocerebellar ataxia
    711115 (MAPK8)
   05020 Prion disease
    711115 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    711115 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    711115 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    711115 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    711115 (MAPK8)
   04931 Insulin resistance
    711115 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    711115 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    711115 (MAPK8)
   05135 Yersinia infection
    711115 (MAPK8)
   05133 Pertussis
    711115 (MAPK8)
   05152 Tuberculosis
    711115 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    711115 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    711115 (MAPK8)
   05161 Hepatitis B
    711115 (MAPK8)
   05171 Coronavirus disease - COVID-19
    711115 (MAPK8)
   05162 Measles
    711115 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    711115 (MAPK8)
   05169 Epstein-Barr virus infection
    711115 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    711115 (MAPK8)
   05142 Chagas disease
    711115 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    711115 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    711115 (MAPK8)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     711115 (MAPK8)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   711115 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 711115
NCBI-ProteinID: XP_015002462
Ensembl: ENSMMUG00000004060
UniProt: H9EQK5
LinkDB
Position
9
AA seq 427 aa
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacaacaatttttatagtgtagagattggagattctacattc
acagtcctgaaacggtatcagaatttaaaacctataggctcaggagcgcaaggaatagta
tgcgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccgacca
tttcagaatcagactcatgccaagcgggcctacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tctgactgcactttgaagattcttgacttcggtctggccaggactgcaggaacaagtttt
atgatgacgccttacgtagtgactcgctactacagagcacccgaggtcatccttggcatg
ggctacaaggaaaacgtggatttatggtctgtggggtgcattatgggagaaatggtttgc
cacaaaatcctctttccaggaagggactatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactgcaaccaacagtaaggacttatgtt
gaaaacagacctaaatatgctggatatagcttcgagaaactcttccctgatgtacttttc
ccagctgactcggaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaatagatgcatctaaaaggatctctgtagatgaagctctccaacacccgtac
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatccctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatataaggaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcgtcgtctgtcaatgatgtgtct
tcaatgtcaacagatccgactttggcctcggatacagacagcagtctagaagcatcagct
gggcctctgggctgctgtagatga

KEGG   Macaca mulatta (rhesus monkey): 715782
Entry
715782            CDS       T01028                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X2
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04024  cAMP signaling pathway
mcc04068  FoxO signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04137  Mitophagy - animal
mcc04140  Autophagy - animal
mcc04141  Protein processing in endoplasmic reticulum
mcc04210  Apoptosis
mcc04215  Apoptosis - multiple species
mcc04217  Necroptosis
mcc04310  Wnt signaling pathway
mcc04380  Osteoclast differentiation
mcc04510  Focal adhesion
mcc04530  Tight junction
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04668  TNF signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc04723  Retrograde endocannabinoid signaling
mcc04728  Dopaminergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04910  Insulin signaling pathway
mcc04912  GnRH signaling pathway
mcc04914  Progesterone-mediated oocyte maturation
mcc04917  Prolactin signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04926  Relaxin signaling pathway
mcc04930  Type II diabetes mellitus
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc05010  Alzheimer disease
mcc05012  Parkinson disease
mcc05016  Huntington disease
mcc05017  Spinocerebellar ataxia
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05132  Salmonella infection
mcc05133  Pertussis
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05161  Hepatitis B
mcc05162  Measles
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05231  Choline metabolism in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    715782 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    715782 (MAPK9)
   04012 ErbB signaling pathway
    715782 (MAPK9)
   04014 Ras signaling pathway
    715782 (MAPK9)
   04310 Wnt signaling pathway
    715782 (MAPK9)
   04668 TNF signaling pathway
    715782 (MAPK9)
   04068 FoxO signaling pathway
    715782 (MAPK9)
   04071 Sphingolipid signaling pathway
    715782 (MAPK9)
   04024 cAMP signaling pathway
    715782 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    715782 (MAPK9)
   04137 Mitophagy - animal
    715782 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    715782 (MAPK9)
   04215 Apoptosis - multiple species
    715782 (MAPK9)
   04217 Necroptosis
    715782 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    715782 (MAPK9)
   04530 Tight junction
    715782 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    715782 (MAPK9)
   04621 NOD-like receptor signaling pathway
    715782 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    715782 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    715782 (MAPK9)
   04660 T cell receptor signaling pathway
    715782 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    715782 (MAPK9)
   04659 Th17 cell differentiation
    715782 (MAPK9)
   04657 IL-17 signaling pathway
    715782 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    715782 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    715782 (MAPK9)
   04920 Adipocytokine signaling pathway
    715782 (MAPK9)
   04912 GnRH signaling pathway
    715782 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    715782 (MAPK9)
   04917 Prolactin signaling pathway
    715782 (MAPK9)
   04926 Relaxin signaling pathway
    715782 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    715782 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    715782 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    715782 (MAPK9)
   04722 Neurotrophin signaling pathway
    715782 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    715782 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    715782 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    715782 (MAPK9)
   05231 Choline metabolism in cancer
    715782 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    715782 (MAPK9)
   05212 Pancreatic cancer
    715782 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    715782 (MAPK9)
   05012 Parkinson disease
    715782 (MAPK9)
   05016 Huntington disease
    715782 (MAPK9)
   05017 Spinocerebellar ataxia
    715782 (MAPK9)
   05020 Prion disease
    715782 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    715782 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    715782 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    715782 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    715782 (MAPK9)
   04931 Insulin resistance
    715782 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    715782 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    715782 (MAPK9)
   05135 Yersinia infection
    715782 (MAPK9)
   05133 Pertussis
    715782 (MAPK9)
   05152 Tuberculosis
    715782 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    715782 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    715782 (MAPK9)
   05161 Hepatitis B
    715782 (MAPK9)
   05171 Coronavirus disease - COVID-19
    715782 (MAPK9)
   05162 Measles
    715782 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    715782 (MAPK9)
   05169 Epstein-Barr virus infection
    715782 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    715782 (MAPK9)
   05142 Chagas disease
    715782 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    715782 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    715782 (MAPK9)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     715782 (MAPK9)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   715782 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 715782
NCBI-ProteinID: XP_014997128
Ensembl: ENSMMUG00000001728
UniProt: G7MUJ7 A0A5S6R977
LinkDB
Position
6
AA seq 424 aa
MSDGKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMAEMVLHKVLFPGRDYIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagcgacggtaaatgtgacagtcagttttacagtgtgcaagtggcagactcaaccttc
actgtcctaaaacgttaccagcagctgaaaccaattggctctggggcccaagggattgtt
tgtgctgcatttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaaccaaactcatgcaaagagagcttatcgtgaactcgtcctcttaaaatgtgtc
aatcataaaaatattattagtttgttaaatgtgtttacaccacaaaaaactctagaagaa
tttcaagatgtgtatctggttatggagttaatggatgctaacttatgtcaggttattcac
atggagctggatcatgaaagaatgtcctaccttctttaccagatgctttgtggtattaaa
catctgcattcagctggtataattcatagagatttgaagcctagcaacatcgttgtgaaa
tcagactgcaccctgaagatccttgactttggcctggcccggacggcctgcaccaacttc
atgatgaccccttacgtggtgacccggtactaccgggcacccgaagtcatcctgggtatg
ggctacaaagagaacgtggacatctggtctgtcgggtgcatcatggcagaaatggtcctc
cataaagtcctgttcccaggaagagactatattgatcagtggaataaagttattgagcag
cttggaacaccatcagcagagttcatgaagaaactgcagccgactgtgaggaattatgta
gaaaacagaccaaagtatcctggaatcaaattcgaagaactctttccagactggatattc
ccatcagagtctgagcgagacaaaataaaaaccagtcaagccagagatctgttatcgaaa
atgctagtgattgatcctgacaagcggatctctgtagacgaagctctgcgtcacccgtac
atcactgtctggtatgacccggccgaagcagaggcaccaccacctcagatttatgatgcc
cagttggaagaaagagaacatgcaattgaagaatggaaagagctaatttacaaagaagtc
atggattgggaagaaagaagcaagaatggtgttgtaaaagatcagccttcagatgcagca
gtaagtagcaacgccactccttctcagtcttcatctatcaatgacatttcatccatgtcc
actgagcagacactggcctcagacacagacagcagtcttgatgcctcgacgggacccctt
gaaggttgtcgatga

DBGET integrated database retrieval system