KEGG   Macaca mulatta (rhesus monkey): 699742Help
Entry
699742            CDS       T01028                                 

Gene name
PCSK1
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mcc01002]
    699742 (PCSK1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mcc03110]
    699742 (PCSK1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     699742 (PCSK1)
Peptidases [BR:mcc01002]
 Serine Peptidases
  Family S8: subtilisin family
   699742 (PCSK1)
Chaperones and folding catalysts [BR:mcc03110]
 Intramolecular chaperones
  Subtilisin family
   699742 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert Peptidase_S8_N OmpA_membrane
Motif
Other DBs
NCBI-GeneID: 699742
NCBI-ProteinID: XP_014995947
Ensembl: ENSMMUG00000005134
UniProt: H9FVB9
LinkDB All DBs
Position
6
AA seq 749 aa AA seqDB search
MERRAWTLQCTAFALFCAWCALNSAKAKRQFVNEWAAEIPGGPEAASAIAEELGYDLLGQ
IGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERTKRSAIKDSAQNL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYAN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECVVKDNDFEPRALK
ANGEVIIEIPTKACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPVGTWTLRITDMSGRIQNEGRIVNWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKMVDPGEEQPTQENTLVSKSPSSSSIGGQRDELEEGAPS
EAMLRLLQSAFSKNSPPKQSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDY
VDVFYNTKPYKHRDDRLLQALVDILNEEN
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaagagcctggactctgcagtgcactgctttcgccctcttttgcgcttggtgt
gcactgaacagtgcaaaagcgaaaagacaatttgttaatgaatgggcagcggagatcccc
gggggcccggaagcagcctcggccatcgccgaggagctgggttatgaccttttgggtcag
attggttcacttgaaaatcactacttattcaaacataaaaaccaccccagaaggtctcga
aggagtgcctttcatatcactaagagattatctgatgatgatcgtgtgatatgggctgaa
caacagtatgaaaaagaaagaactaaacgttcagctataaaggactcagcacaaaatctc
ttcaatgatcccatgtggaatcagcaatggtacttgcaagataccaggatgacagcagcc
ctgcccaagctggaccttcatgtgatacctgtttggcaaaaaggcattacaggcaaagga
gttgttatcaccgtactggatgatggtttggagtggaatcacacggacatttatgccaac
tatgatccagaggctagctatgattttaatgataatgaccatgatccatttccccgatat
gatcccacaaatgagaacaaacatgggaccagatgtgcaggagaaattgccatgcaagca
aataatcacaaatgcggggttggagttgcatacaattccaaagttggaggcataagaatg
ctggatggcattgtgacggatgctattgaggccagttcaattggattcaatcctggacac
gtggatatttatagtgcaagctggggccctaatgatgatgggaaaactgtggaggggcct
ggccggctagcccagaaggcttttgaatatggtgtcaaacaggggagacaggggaagggg
tccatcttcgtctgggcttcgggaaacggggggcgtcagggagataattgtgactgtgat
ggctacacagacagcatctacaccatctccatcagcagtgcctcccagcaaggcctatcc
ccctggtacgctgagaagtgctcctccacactggccacctcttacagcagcggggattac
accgaccagagaatcacgagcgctgacctgcacaatgactgcacggagacgcacacaggc
acctctgcctctgcacctctggctgctggcatcttcgctttggccctggaagcaaaccca
aatctcacctggcgagatatgcagcacctggttgtctggacctctgagtatgacccgctg
gccaataaccctggatggaaaaagaatggagcaggcttgatggtgaatagtcgatttgga
tttggcttgctaaatgccaaagctctggtggatttagctgatcccaggacttggaggagt
gtgcctgagaagaaagagtgtgttgtaaaggacaatgactttgagcccagagccctgaaa
gctaatggagaagttatcattgaaattccaacaaaagcttgtgaaggacaagaaaatgcc
atcaagtccctggagcatgtgcaatttgaagcaacaattgaatattcccgaagaggagac
cttcatgtcacacttacttctgctgctggaactagcactgtgctgttggctgaaagagaa
cgggatacatctcctaatggctttaagaattgggatttcatgtctgttcacacatgggga
gagaaccctgtaggtacttggactttgcgaattacagatatgtctggaagaattcaaaat
gaaggaagaattgtgaactggaagctgattttgcatgggacctcttctcagccagagcat
atgaagcagcctcgtgtgtacacgtcctacaacaccgttcagaatgacagaagaggggtg
gagaagatggtggatccaggggaggagcagcccacacaagagaacaccctggtgtccaaa
agccctagcagcagcagcatagggggccagagggatgagttggaggagggagccccttcc
gaggccatgctgcgactcctacaaagtgctttcagtaaaaactcgccgccaaagcaatca
ccaaagaagtccccaagtgcaaagctcaacatcccttatgaaaacttctatgaagccctg
gaaaagctgaacaaaccttcccagcttaaagactctgaagacagtctctataatgactat
gttgatgttttttataacactaaaccttacaagcacagagatgaccggctgcttcaagct
ctggtggacattctgaatgaggaaaattaa

DBGET integrated database retrieval system