KEGG   Macaca mulatta (rhesus monkey): 699810Help
Entry
699810            CDS       T01028                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00020  Citrate cycle (TCA cycle)
mcc00190  Oxidative phosphorylation
mcc01100  Metabolic pathways
mcc01200  Carbon metabolism
mcc04714  Thermogenesis
mcc04932  Non-alcoholic fatty liver disease (NAFLD)
mcc05010  Alzheimer disease
mcc05012  Parkinson disease
mcc05016  Huntington disease
Module
mcc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mcc_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    699810 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    699810 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    699810 (SDHB)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    699810 (SDHB)
   05012 Parkinson disease
    699810 (SDHB)
   05016 Huntington disease
    699810 (SDHB)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    699810 (SDHB)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     699810 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 699810
NCBI-ProteinID: NP_001248733
Ensembl: ENSMMUG00000001614
UniProt: F7GTK4
LinkDB All DBs
Position
1
AA seq 280 aa AA seqDB search
MAAVVALSLRGRLPATALGGACLQASRGAQTAAAAAPRIKKFAIYRWDPDKAGDKPHMQT
YEIDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcgcactctccttgaggggccggttaccggccacagcacttggcgga
gcctgcctgcaggcctcccgaggagcccagacagctgcagccgcagctccccgtatcaag
aaatttgccatctatcgatgggacccagacaaggctggagacaaacctcatatgcagact
tacgaaattgaccttaataaatgtggccccatggtattggatgctttaatcaagattaag
aatgaaattgactctactttgaccttccgaagatcatgcagagaaggcatctgtggctct
tgtgcaatgaacatcaatggaggcaacactctagcttgcacccgaaggattgacaccaac
ctcaataaggtctcaaaaatctaccctcttccgcatatgtatgtgataaaggaccttgtt
cccgatttgagcaacttctatgctcagtacaaatccattgagccttatttgaagaagaag
gatgaatctcaggaaggcaagcagcagtatctgcagtccatagaagagcgtgagaaactg
gacgggctctacgagtgcattctctgtgcctgctgtagcaccagctgccccagctactgg
tggaacggagacaaatatctggggcctgcagttcttatgcaggcctatcgctggatgatt
gactccagagacgacttcacagaggagcgcctggccaagctgcaggacccgttctctcta
taccgctgccacaccatcatgaactgcacaaggacctgtcctaagggtctgaatccaggg
aaagctattgcggaaatcaagaaaatgatggcaacctataaggagaagaaagcttcagtt
taa

DBGET integrated database retrieval system