KEGG   Macaca mulatta (rhesus monkey): 700030
Entry
700030            CDS       T01028                                 

Gene name
FOXO1
Definition
(RefSeq) forkhead box protein O1
  KO
K07201  forkhead box protein O1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04068  FoxO signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04218  Cellular senescence
mcc04910  Insulin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc04922  Glucagon signaling pathway
mcc04931  Insulin resistance
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc05165  Human papillomavirus infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    700030 (FOXO1)
   04152 AMPK signaling pathway
    700030 (FOXO1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    700030 (FOXO1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    700030 (FOXO1)
   04922 Glucagon signaling pathway
    700030 (FOXO1)
   04919 Thyroid hormone signaling pathway
    700030 (FOXO1)
  09149 Aging
   04211 Longevity regulating pathway
    700030 (FOXO1)
   04213 Longevity regulating pathway - multiple species
    700030 (FOXO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    700030 (FOXO1)
   05202 Transcriptional misregulation in cancer
    700030 (FOXO1)
  09162 Cancer: specific types
   05215 Prostate cancer
    700030 (FOXO1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    700030 (FOXO1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    700030 (FOXO1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    700030 (FOXO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    700030 (FOXO1)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    700030 (FOXO1)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 700030
NCBI-ProteinID: XP_001088437
Ensembl: ENSMMUG00000030780
UniProt: F6ZVZ0
LinkDB
Position
17
AA seq 655 aa
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGGAAANPDAAAGLPS
ASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHP
APPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKR
LTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLN
PEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPG
SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLP
SLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPN
YQKYTYGQSSMNPLPQMPMQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPV
DPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRALS
HTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALAGYSSVSSCNGYGRMGLLHQEKLPS
DLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
NT seq 1968 nt   +upstreamnt  +downstreamnt
atggccgaagcgcctcaggtggtggagatcgacccggacttcgagccgctgccccggccg
cgctcgtgcacctggccgctgcccaggccggagtttagccagtccaactcggccacctcc
agcccggcgccgtcgggcggcgcggctgccaaccccgacgccgcggcgggcctgccctcg
gcctcggctgccgctgtcagcgccgacttcatgagcaacctgagcttgctggaggagagc
gaggactttccgcaagcacccggctccgtggcggcggcggtggcggcggcggccgccgcg
gccgccaccgggggactgtgcggggacttccaaggcccggaggcgggctgcctgcaccca
gcgccgccgcagcccccgccgcccgggccgctgtcgcagcacccgccagtgccccccgcc
gccgctgggcctctcgcggggcagccgcgcaagagcagctcgtcccgccgcaacgcgtgg
ggcaacctgtcctacgctgacctcatcaccaaggccatcgagagctcggcggagaagcgg
ctgacgctgtcgcagatctacgagtggatggtcaagagcgtgccctacttcaaggataag
ggtgacagcaacagctcggcgggctggaagaattcaattcgtcataatctgtccctacac
agcaagttcattcgtgtgcagaatgaaggaactggaaaaagttcttggtggatgctcaat
ccagagggcggcaagagcgggaaatctcccaggagaagagccgcatccatggacaacaat
agtaaatttgctaagagccgaagccgagctgccaagaagaaagcatccctccagtctggc
caggagggtgctggggacagccctggatcacagttttccaaatggcctgcaagccctggc
tctcatagcaacgacgactttgataactggagtacatttcgccctcgaactagctcaaat
gctagtactattagtgggagactctcacccattatgaccgaacaggatgatcttggagaa
ggggatgtgcattctatggtgtacccgccatctgccgcaaagatggcctctactttaccc
agtctgtctgagataagcaatcccgaaaacatggaaaatcttttggataatctcaacctt
ctctcatcaccaacatcattaactgtttcgacccagtcctcacctggcaccatgatgcag
cagacaccatgctactcgtttgcgccaccaaacaccagtttgaattcacccagcccaaac
taccaaaaatatacatatggccaatccagcatgaaccctttaccccagatgcctatgcaa
acacttcaggacaataagtcaagttacggagggatgagtcagtataactgtgcacctgga
ctcttgaaggagttgctgacttctgactctcctccccacaatgacattatgacaccagtt
gatcctggggtagctcaacccaacagccgggttctgggccagaacgtcatgatgggccct
aattcggtcatgtcaacctatggcagccaggcatctcataacaaaatgatgaatcccagc
tcccatacccaccctggacacgctcagcagacatctgcagttaacgggcgtgccctgtcc
cacacggtaagcaccatgccccacacctcgggaatgaaccgcctgacccaagtgaagaca
cctgtgcaagtgcctctgccccaccccatgcagatgagtgccctggcgggctactcctcc
gtgagcagctgcaatggctatggcagaatgggccttctccaccaggagaagctcccaagt
gacttggatggcatgttcattgagcgcttagactgtgacatggaatccatcattcggaat
gacctcatggatggagatacattggattttaactttgacaatgtgttgcccaaccaaagc
ttcccacacagtgtcaagacgacgacacatagctgggtgtcaggctga

DBGET integrated database retrieval system