KEGG   Macaca mulatta (rhesus monkey): 700141
Entry
700141            CDS       T01028                                 

Gene name
ISG15
Definition
(RefSeq) ubiquitin-like protein ISG15
  KO
K12159  ubiquitin cross-reactive protein
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc05165  Human papillomavirus infection
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    700141 (ISG15)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    700141 (ISG15)
   05169 Epstein-Barr virus infection
    700141 (ISG15)
   05165 Human papillomavirus infection
    700141 (ISG15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    700141 (ISG15)
Ubiquitin system [BR:mcc04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   700141 (ISG15)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 Ubiquitin_5 UN_NPL4 DUF2407 USP7_ICP0_bdg
Other DBs
NCBI-GeneID: 700141
NCBI-ProteinID: NP_001253735
Ensembl: ENSMMUG00000001819
UniProt: A0A1D5QQL5
LinkDB
Position
1
AA seq 165 aa
MSWDLKVKMLGGNEFQVSLSNSMSVSELKAKIAQKIGVHAFQQRLAVHPSGATLQDRVPL
ANQGLGPGSTVLLVVDKCDEPLSILVRNDKGRSSTYEVQLTQTVAHLKQQVSRQEGVQDD
LFWLTFEGKPLENQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGQS
NT seq 498 nt   +upstreamnt  +downstreamnt
atgagctgggacctgaaggtgaagatgctggggggcaacgagttccaggtgtccctgagc
aactccatgtcggtgtcagagctgaaggcaaagatcgcccagaagatcggcgtgcacgcc
ttccagcagcgtctggctgtccaccccagcggcgccaccctgcaggacagggttcccctt
gccaaccagggcctgggccccggcagcacggtcctgctggtggtggacaagtgcgatgaa
cctctgagcatcctggtgaggaacgacaagggccggagcagcacctacgaggtacagctg
acgcagactgtggcccacctgaagcagcaagtgagccggcaggagggtgtgcaggacgac
ctgttctggctgaccttcgaggggaagcccctggagaatcagctcccactgggggagtac
ggcctcaagcccctgagcaccgtgttcatgaatctgcgcctgcggggaggcggcacagag
cctggcgggcagagctaa

DBGET integrated database retrieval system