KEGG   Macaca mulatta (rhesus monkey): 700197
Entry
700197            CDS       T01028                                 

Gene name
GAB2
Definition
(RefSeq) GRB2-associated-binding protein 2
  KO
K08091  GRB2-associated-binding protein 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04380  Osteoclast differentiation
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    700197 (GAB2)
   04072 Phospholipase D signaling pathway
    700197 (GAB2)
   04071 Sphingolipid signaling pathway
    700197 (GAB2)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    700197 (GAB2)
   04666 Fc gamma R-mediated phagocytosis
    700197 (GAB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    700197 (GAB2)
 09160 Human Diseases
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    700197 (GAB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcc04990]
    700197 (GAB2)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   700197 (GAB2)
SSDB
Motif
Pfam: PH PH_11 PH_9 PH_3 PH_2 PH_8
Other DBs
NCBI-GeneID: 700197
NCBI-ProteinID: XP_014970821
Ensembl: ENSMMUG00000017477
UniProt: F6VIK2
LinkDB
Position
14
AA seq 677 aa
MSGGGGDVVCTGWLRKSPPEKKLRRYAWKKRWFILRSGRMSGDPDVLEYYKNDHSKKPLR
IINLNFCEQVDAGLTFNKKELQDSFVFDVKTSERTFYLVAETEEDMNKWVQSICQICGFN
QAEESTDTLRNVSSAGHGPRSSPAELSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNH
MQPALSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVN
GVSGQVHGFYSLPKPSRHNTEFRDSTYDLPRSLASHGHTKGSLTGSETDNEDVYTFKTPS
NTLCREFGDLLVDNMDVPATPLSAYQIPRTFTLDKNHNAMTVATPGDSAIAPPPRPPKPS
QAETPRWGSPQQRPPISENSRSVAATIPRRNTLPAMDNSRLHRASSCETYEYPQRGGESA
GRSAESMSDGVGSLLPGKMTVGRSDSTNSEDNYVPMNPGSSTLLAMERAGDNSQSVYIPM
SPGAHHFDSLGYPSTTLPMHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDEL
PFKSPITKSWSRASHTFNSSSSQYCRPISTQSITSTDSGDSEENYVPMQNPVSASPVPSG
TNSPAPKKSTGSVDYLALDFQPSSPSPHRKPSTSSVTSDEKVDYVQVDKEKTQALQNTMQ
EWTDVRQSSEPSKGAKL
NT seq 2034 nt   +upstreamnt  +downstreamnt
atgagcggcggcggcggcgacgtggtgtgcaccggctggctgaggaaatcgcctcccgag
aagaagttgaggcgctatgcctggaagaaacgctggtttatcctacggagtggccggatg
agcggtgacccagatgttctggaatactacaagaacgatcactccaagaagcctctgcgg
atcatcaacctgaacttctgtgagcaggtggatgcaggcctgacctttaacaagaaggag
ctgcaggatagttttgtgtttgacgtcaagaccagcgagcgcaccttttacctggtggct
gagacagaagaggacatgaataagtgggtccagagcatctgccagatctgtggcttcaat
caggctgaggagagcacagacaccctgagaaacgtttcctcagctggtcatggcccccgc
tcttctccagctgagctcagcagctctagccagcaccttctccgagagcgcaagtcctca
gccccatcacactccagccagccaactctgttcacgtttgaaccccctgtgtcaaaccac
atgcagcccgccttgtccaccagtgcacctcaggagtatctctacttgcaccagtgcata
agccgaagagcagaaaatgcaaggagtgccagcttctctcagggcaccagagcctctttt
ctcatgagaagtgacacggctgtacaaaaacttgcccagggcaatggacactgtgtcaac
ggggtcagtggtcaagtccatggcttctatagccttcctaagccgagccggcacaataca
gaattcagagacagtacctacgacctcccccgcagcctggcctcccatggccacaccaag
ggcagcctcacaggctctgagacagataatgaggatgtgtacacctttaagacacccagc
aacaccctgtgccgggagtttggggacctcctggtagacaatatggatgttccggccacc
ccactctcagcctaccagatccctaggacattcactctggacaaaaaccataatgccatg
acagtggccactcctggggactcagccatagctcccccaccccgcccccccaagccaagt
caggcagaaacacctcgatggggtagtcctcagcagagacctccaatcagtgaaaatagc
agatctgtcgctgccaccattcccagacgcaacaccctccctgcaatggacaacagccga
cttcaccgagcttcttcctgtgagacctacgagtacccacagcgtggtggagagagtgca
ggccggtctgctgaatccatgagtgatggagtcggctctttactgccagggaaaatgact
gtgggccgatcagacagcaccaattctgaagacaactatgtgcccatgaacccaggttct
tccaccctgttggccatggaacgagcaggtgataattcccagagcgtctacatcccaatg
agcccaggggcccatcactttgactcacttggctacccatcaacaacccttcctatgcac
cgaggccccagcagaggaagtgagatccagccaccccctgtcaaccgcaacctcaaacct
gatcggaaagcaaagccaacaccacttgacctgagaaacaacactgtcatcgatgaactc
cccttcaagtcacctatcaccaagtcttggtctagggccagccacaccttcaactccagc
tcctcccagtactgccgccccatctccacccagagcatcaccagcacagactcaggagac
agcgaagagaactacgtccctatgcaaaacccagtgtctgcatctcccgttcccagtggc
accaacagtcctgcccctaagaagagcaccggcagcgtcgattatctggccctggacttc
cagccgagctccccaagcccccaccgcaagccatctacttcatctgtcacttctgatgag
aaggtggactatgttcaggtggacaaggagaagacccaggccctgcagaacaccatgcag
gagtggacagacgtgcggcagtcctcggagccttccaagggtgccaagctgtga

KEGG   Macaca mulatta (rhesus monkey): 700367
Entry
700367            CDS       T01028                                 

Gene name
GAB1
Definition
(RefSeq) GRB2-associated-binding protein 1
  KO
K09593  GRB2-associated-binding protein 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc05100  Bacterial invasion of epithelial cells
mcc05205  Proteoglycans in cancer
mcc05211  Renal cell carcinoma
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    700367 (GAB1)
   04014 Ras signaling pathway
    700367 (GAB1)
   04072 Phospholipase D signaling pathway
    700367 (GAB1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    700367 (GAB1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    700367 (GAB1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    700367 (GAB1)
   05226 Gastric cancer
    700367 (GAB1)
   05211 Renal cell carcinoma
    700367 (GAB1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    700367 (GAB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    700367 (GAB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcc04990]
    700367 (GAB1)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   700367 (GAB1)
SSDB
Motif
Pfam: PH PH_11 PH_9 PH_8 PH_3 PH_13
Other DBs
NCBI-GeneID: 700367
NCBI-ProteinID: NP_001253361
Ensembl: ENSMMUG00000000828
UniProt: F6Q209 G7MS19
LinkDB
Position
5
AA seq 724 aa
MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRII
DLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPT
EEDPVKPPGSSLQAPADLPLAINTAPPSTQADSSSATLPPPYQLINVPPHLETLGIQEDP
QDYLLLINCQSKKPEPTRTHADSAKSTSSETDCNDNVPSHKNPASSQSKHGMNGFFQQQM
IYDSPPSRATSASVDSSLYNLPRSYSHDVLPKVSPSSTEADGELYVFNTPSGTSSVETQM
RHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHPAHDRSPVETC
SIPRTASDTDNSYCIPTAGMPPSRSNTISTVDLNKLRKDTSSQDCYDIPRTFPSDRSSSL
EGFHNHFKVKNVLTVGSVSSEELDENYVPMNPNSPPRQHSSSFTEPIQEANYVPMTPGTF
DFSSFGMQVPPPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKGQSPKILRLKPH
GLERTDSQTIGDFATRRKVKPAPLEIKPLPEWEELQAPVRSPITRSFARDSSRFPMSPRP
DSVHSTTSSSDSHDSEENYVPMNPNLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDL
DLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPT
KSVK
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagcggtggtgaagtggtctgctccggatggctccgcaagtcccccccggagaaaaag
ttgaagcgttatgcatggaagaggagatggttcgtgttacgcagtggccgtttaactgga
gatccagatgttttggaatattacaaaaatgatcatgccaagaagcctattcgtattatt
gatttaaatttatgtcaacaagtagatgctggattgacatttaacaaaaaagagtttgaa
aacagctacatttttgatatcaacactattgaccggattttctacttggtagcagacagc
gaggaggagatgaataagtgggttcgttgtatttgtgacatctgtgggtttaatccaaca
gaagaagatcctgtaaagccacctggcagctccttacaagcaccagctgatttaccttta
gctataaatacagcaccaccatccacccaggcggattcatcctctgctactctacctcct
ccatatcagctaatcaatgttccaccacacctggaaactcttggcattcaggaggatcct
caagactacctgttgctcatcaactgtcaaagcaagaaacccgaacccaccagaacacac
gctgattctgcaaaatccacctcttctgaaacagactgcaatgataacgtcccttctcat
aaaaatcctgcttcctcccagagcaaacatggaatgaatggcttttttcagcagcaaatg
atatacgactctccaccttcacgtgccacatctgcttcagttgactccagcctttataac
ctgcccagaagttattcccatgatgttttaccaaaggtgtctccgtcaagtactgaagca
gatggagaactctatgtttttaataccccatctgggacatcgagtgtagagactcaaatg
aggcatgtatctattagttatgacattcctccaacacctggtaatacttatcagattcca
cgaacatttccagaaggaaccttgggacagacatcaaagctagacactattccagatatt
cctccacctcggccaccgaaaccacatccagctcatgaccgatctcctgtggaaacgtgt
agtatcccacgcaccgcctcagacactgacaatagttactgtatccctacagcagggatg
ccgccatcacgtagtaataccatttccactgtggatttaaacaaattgcgaaaagatact
agttctcaagactgctatgatattccacggacatttccaagtgatagatctagttcactt
gaaggcttccataaccattttaaagtcaaaaatgtgttgacagtgggaagtgtttcaagt
gaagaactggatgaaaattacgtcccaatgaatcccaattcaccaccacgacaacattcc
agcagttttacagaaccaattcaggaagccaattatgtgccaatgactccaggaacattt
gatttttcctcatttggaatgcaagttcctcctcctgctcatatgggcttcaggtccagc
ccaaaaacccctcccagaaggccagttcctgttgcagactgtgaaccaccccccgtggat
aggaacctcaagccagacagaaaaggtcaaagtcctaaaattttaagactcaaaccccat
ggtttagagcgaactgattcacaaaccataggtgactttgctacaagaagaaaggtcaag
ccagcacctttagaaataaaacctttgccagaatgggaagaattacaagccccagttaga
tctcccatcactaggagttttgctcgagactcttctaggtttcccatgtccccccgaccg
gattcagtgcatagcacaacttcaagcagtgactcacatgacagtgaagagaattatgtt
cccatgaacccaaacctgtccagtgaagacccaaatctctttggcagtaacagtcttgat
ggaggaagcagccctatgatcaagcccaaaggagacaaacaggtggaatacctagatctc
gacttggattctgggaaatccacaccaccacgtaagcaaaagagcagtggctcaggcagc
agtgtagcagatgagagagtggattatgttgttgttgaccaacagaagaccttggcccta
aagagtacccgggaagcctggacagatgggagacagtccacagaatcagaaacgccaaca
aagagtgtgaaatga

DBGET integrated database retrieval system