KEGG   Macaca mulatta (rhesus monkey): 700236
Entry
700236            CDS       T01028                                 

Gene name
PDGFC
Definition
(RefSeq) platelet-derived growth factor C
  KO
K05450  platelet derived growth factor C/D
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04540  Gap junction
mcc04810  Regulation of actin cytoskeleton
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    700236 (PDGFC)
   04014 Ras signaling pathway
    700236 (PDGFC)
   04015 Rap1 signaling pathway
    700236 (PDGFC)
   04020 Calcium signaling pathway
    700236 (PDGFC)
   04072 Phospholipase D signaling pathway
    700236 (PDGFC)
   04151 PI3K-Akt signaling pathway
    700236 (PDGFC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    700236 (PDGFC)
   04540 Gap junction
    700236 (PDGFC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    700236 (PDGFC)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    700236 (PDGFC)
  09162 Cancer: specific types
   05218 Melanoma
    700236 (PDGFC)
   05215 Prostate cancer
    700236 (PDGFC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    700236 (PDGFC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    700236 (PDGFC)
Cytokines and growth factors [BR:mcc04052]
 Growth factors
  Growth factors (RTK binding)
   700236 (PDGFC)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 700236
NCBI-ProteinID: XP_001093265
Ensembl: ENSMMUG00000022900
UniProt: A0A5F8ASK5
LinkDB
Position
5
AA seq 345 aa
MLLLRLLLLTSALAGQRQGTQAESNLSSKFQFSNNKEQNGVQDPQHERIITVSTNGSIHS
PRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSA
LPLDLLNNAITAFSTLEDLIRYLEPDRWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgctcctcctcaggcttctcctgctgacatctgccctggccggccagagacaggggact
caggcggaatccaacctgagtagtaaattccagttctccaacaacaaggaacagaacgga
gtacaagatcctcagcatgagagaattattactgtgtctactaatggaagtattcacagc
ccaagatttcctcatacttatccaagaaatacagtcttggtatggagattagtagcagta
gaggaaaatgtatggatacaacttacgtttgatgaaagatttgggcttgaagacccagaa
gatgacatatgcaagtatgattttgtagaagttgaggaacccagtgatggaactatatta
gggcgctggtgtggttctggtactgtaccaggaaaacagatttctaaaggaaatcaaatt
aggataagatttgtatctgatgaatattttccttctgaaccagggttctgcatccactac
aacattgtcatgccacaattcacagaagctgtgagtccttcagtgttacccccttcagct
ttgccactggacctgcttaataatgctataactgccttcagtaccttggaagaccttatt
cgatatcttgaaccagatagatggcagttggacttagaagatctatataggccaacttgg
caacttcttggcaaggcttttgtttttggaagaaaatccagagtggtggatctgaacctt
ctaacagaggaggtaagattatacagctgcacacctcgtaacttctcagtatccataagg
gaagaactaaagagaaccgataccattttctggccaggttgtctcctggttaaacgctgt
ggagggaactgtgcctgttgtctccacaattgcaatgaatgtcaatgtgtcccaagcaaa
gttactaaaaaataccatgaggtccttcagttgagaccaaagactggtgtcagaggattg
cataaatcactcactgatgtggccctagagcaccatgaggagtgtgactgtgtgtgcaga
gggagcacaggaggataa

KEGG   Macaca mulatta (rhesus monkey): 703173
Entry
703173            CDS       T01028                                 

Gene name
PDGFB
Definition
(RefSeq) platelet-derived growth factor subunit B
  KO
K17386  platelet-derived growth factor subunit B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04540  Gap junction
mcc04630  JAK-STAT signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05211  Renal cell carcinoma
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05231  Choline metabolism in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    703173 (PDGFB)
   04014 Ras signaling pathway
    703173 (PDGFB)
   04015 Rap1 signaling pathway
    703173 (PDGFB)
   04630 JAK-STAT signaling pathway
    703173 (PDGFB)
   04020 Calcium signaling pathway
    703173 (PDGFB)
   04072 Phospholipase D signaling pathway
    703173 (PDGFB)
   04151 PI3K-Akt signaling pathway
    703173 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    703173 (PDGFB)
   04540 Gap junction
    703173 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    703173 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    703173 (PDGFB)
   05206 MicroRNAs in cancer
    703173 (PDGFB)
   05231 Choline metabolism in cancer
    703173 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    703173 (PDGFB)
   05218 Melanoma
    703173 (PDGFB)
   05211 Renal cell carcinoma
    703173 (PDGFB)
   05215 Prostate cancer
    703173 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    703173 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    703173 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    703173 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    703173 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    703173 (PDGFB)
Cytokines and growth factors [BR:mcc04052]
 Growth factors
  Growth factors (RTK binding)
   703173 (PDGFB)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   703173 (PDGFB)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 703173
NCBI-ProteinID: XP_001097395
Ensembl: ENSMMUG00000002739
UniProt: G7N3W3 A0A1D5Q4I7
LinkDB
Position
10
AA seq 241 aa
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAEL
DLNMTRSHSGGELESLARGRRSLGSLTVAEPAMIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttcctgtctctctgctgctacctgcgtctggtcagcgcc
gagggggaccccattcccgaggagctctatgagatgctaagtgaccactccatccgctcc
ttcgatgatctccagcgcctgctgcacggagaccctggagaggaagatggggccgagttg
gacctgaacatgacccgctcccactctggaggcgagctggagagcctggctcgtggaaga
aggagcttgggttccctgaccgttgctgagccagccatgatcgccgagtgcaagactcgc
accgaggtgttcgagatctcccggcgcctcatagaccgcaccaatgccaacttcctggtg
tggccgccctgcgtggaggtgcagcgctgctccggctgctgcaacaaccgcaacgtgcag
tgccgccccacccaggtgcagctgcggcccgtccaggtgagaaagatcgagattgtgcgg
aagaagccaatctttaagaaggccacggtgacgctggaggaccacctggcatgcaagtgt
gagacagtggcggctgcacggcctgtgacccgaagcccggggggttcccaggagcagcga
gccaaaacaccccaaactcgggtgaccattcggacggtgcgagtccgccggccccccaag
ggcaagcaccggaaattcaagcacacgcatgacaagacggcactgaaggagaccctcgga
gcctag

KEGG   Macaca mulatta (rhesus monkey): 704310
Entry
704310            CDS       T01028                                 

Gene name
PDGFD
Definition
(RefSeq) platelet-derived growth factor D isoform X2
  KO
K05450  platelet derived growth factor C/D
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04540  Gap junction
mcc04810  Regulation of actin cytoskeleton
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    704310 (PDGFD)
   04014 Ras signaling pathway
    704310 (PDGFD)
   04015 Rap1 signaling pathway
    704310 (PDGFD)
   04020 Calcium signaling pathway
    704310 (PDGFD)
   04072 Phospholipase D signaling pathway
    704310 (PDGFD)
   04151 PI3K-Akt signaling pathway
    704310 (PDGFD)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    704310 (PDGFD)
   04540 Gap junction
    704310 (PDGFD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    704310 (PDGFD)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    704310 (PDGFD)
  09162 Cancer: specific types
   05218 Melanoma
    704310 (PDGFD)
   05215 Prostate cancer
    704310 (PDGFD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    704310 (PDGFD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    704310 (PDGFD)
Cytokines and growth factors [BR:mcc04052]
 Growth factors
  Growth factors (RTK binding)
   704310 (PDGFD)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 704310
NCBI-ProteinID: XP_001099412
Ensembl: ENSMMUG00000005353
UniProt: I0FL10
LinkDB
Position
14
AA seq 364 aa
MHRLIFVYTLVCANFCSCRDTSATPQSASIKALRNANLRRDDLYRRDETIQVKGNGFVQS
PRFPNSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDISETSTII
RGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYSLVEDFQPAAASETNWESV
TSSISGVSYNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMYLNTPRY
RGRSYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNC
GCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRKGRAKAMALVDIQLDHHERCDCICSS
RPPR
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgcaccggctcatctttgtctacactctagtctgcgcaaacttttgcagctgtcgggac
acttctgcaactccgcagagcgcatccatcaaagctttgcgcaacgccaacctcaggaga
gatgacttgtaccgaagagatgagaccatccaggtgaaaggaaacggcttcgtgcagagt
cctcggttcccgaacagctaccccaggaacctgctcctgacatggcggctccactctcag
gagaatacgaggatacagctagtgtttgacaatcagtttgggttagaggaagcagaaaat
gatatctgtaggtatgattttgtggaagttgaagatatatccgaaaccagtaccattatt
agaggacgatggtgtggacacaaggaagttcctccaaggataaaatcaagaacaaaccaa
attaaaatcacattcaagtccgatgactactttgtggctaaacctggattcaagatttat
tattctttggtggaagatttccaacccgcagcagcttcagagaccaactgggaatcagtc
acaagctctatttcaggggtatcctataactctccatcagtaacggatcccactctcatt
gcggatgctctggacaaaaaaattgcagaatttgataccgtggaagatctgctcaagtac
ttcaatccagagtcatggcaagaagatcttgagaatatgtatttgaacactcctcgttat
cgaggcaggtcatatcatgaccggaagtcaaaagttgacctggataggctcaacgatgat
gccaagcgttacagttgcactcccaggaattactcggtcaatataagagaagagctgaag
ctggccaatgtggtcttctttccacgttgcctcctcgtgcagcgctgtggaggaaattgt
ggctgtggaactgtcaactggaggtcctgcacatgcaattcagggaaaaccgtgaaaaag
tatcatgaggtattacagtttgagcctggccacatcaagaggaagggcagagctaaggcc
atggctctggttgacatccagttggatcaccatgaacgatgcgattgtatctgcagctca
aggccacctcgataa

KEGG   Macaca mulatta (rhesus monkey): 707725
Entry
707725            CDS       T01028                                 

Gene name
PDGFA
Definition
(RefSeq) platelet-derived growth factor subunit A isoform X1
  KO
K04359  platelet-derived growth factor subunit A
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04540  Gap junction
mcc04630  JAK-STAT signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05206  MicroRNAs in cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05231  Choline metabolism in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    707725 (PDGFA)
   04014 Ras signaling pathway
    707725 (PDGFA)
   04015 Rap1 signaling pathway
    707725 (PDGFA)
   04630 JAK-STAT signaling pathway
    707725 (PDGFA)
   04020 Calcium signaling pathway
    707725 (PDGFA)
   04072 Phospholipase D signaling pathway
    707725 (PDGFA)
   04151 PI3K-Akt signaling pathway
    707725 (PDGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    707725 (PDGFA)
   04540 Gap junction
    707725 (PDGFA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    707725 (PDGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    707725 (PDGFA)
   05202 Transcriptional misregulation in cancer
    707725 (PDGFA)
   05206 MicroRNAs in cancer
    707725 (PDGFA)
   05231 Choline metabolism in cancer
    707725 (PDGFA)
  09162 Cancer: specific types
   05214 Glioma
    707725 (PDGFA)
   05218 Melanoma
    707725 (PDGFA)
   05215 Prostate cancer
    707725 (PDGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    707725 (PDGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    707725 (PDGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    707725 (PDGFA)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    707725 (PDGFA)
Cytokines and growth factors [BR:mcc04052]
 Growth factors
  Growth factors (RTK binding)
   707725 (PDGFA)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   707725 (PDGFA)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 707725
NCBI-ProteinID: XP_028701251
LinkDB
Position
3
AA seq 256 aa
MWVEGPHSDAPGFGSWAGAHGSRQEPGWSARPAASPLRRASSASGRDEDLGLPAATRLRI
PRPCFGRGSRDPPRGDREAGAQSDPQHPGPPATPGDRLRSEDPLDTSLRVHGVHATKHAA
EKRPLPIRRKRSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNT
SSVKCQPSRIHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGR
PRESGKKRKRKRLKPT
NT seq 771 nt   +upstreamnt  +downstreamnt
atgtgggtggagggtcctcattcagatgccccaggcttcggatcctgggcgggggcgcat
ggcagccgccaggagcctggctggagcgcccgccccgcggcctcgcctctccgccgagcc
tccagcgcctcgggacgcgatgaggacctgggcttgcctgctgctactcggctgcggata
cctcgcccatgctttggccgaggaagccgagatcccccgcgaggtgatcgagaggctggc
gcacagtcagatccacagcatccgggacctccagcgactcctggagatagactccggagt
gaggatcctttggacaccagcctgagagttcacggggtccacgccaccaagcatgcggct
gagaagcggcccctgcccattcgaaggaagagaagcattgaggaagctgtccccgctgtc
tgcaagaccaggacggtcatttacgagattcctcggagtcaggttgaccccacgtccgcc
aacttcctgatctggcccccgtgcgtggaggtgaagcgctgcaccggctgctgcaacaca
agcagtgtcaagtgccagccctcacgcatccaccaccgcagcgtcaaggtggccaaggtg
gaatacgtcaggaagaaaccaaaattaaaagaagtccaggtgaggttagaggagcatttg
gagtgcgcctgcgcaaccaccagcctgaatccggattatcgggaagaggacacaggaagg
cctagggagtcaggtaaaaaacggaaaagaaaaaggttaaaacccacctaa

DBGET integrated database retrieval system