KEGG   Macaca mulatta (rhesus monkey): 700382
Entry
700382            CDS       T01028                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2 isoform X2
  KO
K06626  G1/S-specific cyclin-E1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04110  Cell cycle
mcc04114  Oocyte meiosis
mcc04115  p53 signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04218  Cellular senescence
mcc04934  Cushing syndrome
mcc05161  Hepatitis B
mcc05162  Measles
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05206  MicroRNAs in cancer
mcc05215  Prostate cancer
mcc05222  Small cell lung cancer
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    700382 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    700382 (CCNE2)
   04114 Oocyte meiosis
    700382 (CCNE2)
   04115 p53 signaling pathway
    700382 (CCNE2)
   04218 Cellular senescence
    700382 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    700382 (CCNE2)
   05206 MicroRNAs in cancer
    700382 (CCNE2)
   05203 Viral carcinogenesis
    700382 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    700382 (CCNE2)
   05215 Prostate cancer
    700382 (CCNE2)
   05222 Small cell lung cancer
    700382 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    700382 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    700382 (CCNE2)
   05161 Hepatitis B
    700382 (CCNE2)
   05162 Measles
    700382 (CCNE2)
   05169 Epstein-Barr virus infection
    700382 (CCNE2)
   05165 Human papillomavirus infection
    700382 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mcc03032]
    700382 (CCNE2)
   03036 Chromosome and associated proteins [BR:mcc03036]
    700382 (CCNE2)
DNA replication proteins [BR:mcc03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    700382 (CCNE2)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    700382 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 700382
NCBI-ProteinID: XP_002808530
Ensembl: ENSMMUG00000005358
LinkDB
Position
8
AA seq 404 aa
MSRRSSRLQAKQQPQPSQTESPQEVQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPP
VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKK
ESRYVHEKHLEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDI
NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCP
VTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAA
LCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTH
TNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtcaagacgaagtagccgtttacaagctaagcagcagccccagcccagccagacggag
tcaccccaagaagtccagataatccaggccaagaagaggaaaacaacccaggatgtcaaa
aaaagaagagaggaggtcaccaagaaacatcagtatgaaattaggaattgttggccacct
gtattatctggggggatcagtccttgcattatcattgaaacacctcacaaagaaatagga
acaagtgatttctccagatttacaaattacagatttaaaaatctttttattaatccttca
cctttgcctgatttaagctggggatgttcaaaagaagtctggctaaacatgttaaaaaag
gagagcagatatgttcatgaaaaacatcttgaagttctgcattctgacttggaaccacag
atgaggtccatacttctagactggcttttagaggtatgtgaagtatacacacttcatagg
gaaacattttatcttgcacaagacttttttgatagatttatgttgacacaaaaggatata
aataaaaatatgcttcaactcattggaattacctcattattcattgcttccaaacttgag
gaaatctacgctcctaaactccaagagtttgcttacgtcactgatggtgcttgcagtgaa
gaggatatcttaaggatggaactcattatattaaaggctttaaaatgggaactttgtcct
gtaacaatcatctcctggctaaatctctttctccaagttgatgctcttaaagatgctcct
aaagttcttctacctcagtattctcaggaaacattcattcaaatagctcagcttttagat
ctgtgtattctagccattgattcattagagttccagtacagaatactgactgctgctgcc
ctgtgccattttacctccattgaagtggttaagaaagcctcaggtttggagtgggacagt
atttcagaatgtgtagattggatggtaccttttgtcaatgtagtaaaaagtactagtcca
gtgaagctgaagacttttaagaagattcctatggaagacagacataatatccagacacat
acaaattatttggctatgctggaagaagtaaattacataaacaccttcagaaaaggggga
cagttgtcaccagtgtgcaatggaggcatcatgacaccaccgaagagcaccgaaaaacca
ccaggaaaacactaa

KEGG   Macaca mulatta (rhesus monkey): 700589
Entry
700589            CDS       T01028                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04110  Cell cycle
mcc04114  Oocyte meiosis
mcc04115  p53 signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04218  Cellular senescence
mcc04934  Cushing syndrome
mcc05161  Hepatitis B
mcc05162  Measles
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05206  MicroRNAs in cancer
mcc05215  Prostate cancer
mcc05222  Small cell lung cancer
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    700589 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    700589 (CCNE1)
   04114 Oocyte meiosis
    700589 (CCNE1)
   04115 p53 signaling pathway
    700589 (CCNE1)
   04218 Cellular senescence
    700589 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    700589 (CCNE1)
   05206 MicroRNAs in cancer
    700589 (CCNE1)
   05203 Viral carcinogenesis
    700589 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    700589 (CCNE1)
   05215 Prostate cancer
    700589 (CCNE1)
   05222 Small cell lung cancer
    700589 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    700589 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    700589 (CCNE1)
   05161 Hepatitis B
    700589 (CCNE1)
   05162 Measles
    700589 (CCNE1)
   05169 Epstein-Barr virus infection
    700589 (CCNE1)
   05165 Human papillomavirus infection
    700589 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mcc03032]
    700589 (CCNE1)
   03036 Chromosome and associated proteins [BR:mcc03036]
    700589 (CCNE1)
DNA replication proteins [BR:mcc03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    700589 (CCNE1)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    700589 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 700589
NCBI-ProteinID: XP_014978961
Ensembl: ENSMMUG00000020668
UniProt: F7BEI4
LinkDB
Position
19
AA seq 410 aa
MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVAVFLQDPDEEMAKIDRTARDQCGSQ
PWDNNTGCADPCSLIPTPDKEDDERVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIM
LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR
LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA
ASALYHFSSSELTQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI
QTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSSKKQSSEPEMA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgccgagggagcgcagggagcgggatgcgaaggagcgggacaccatgaaggaggacggc
ggcgcggagttctcggctcgctccaggaagaggaaggcaaacgtggccgtttttttgcag
gatccagatgaagaaatggccaaaatcgacaggacggcgagggaccagtgtgggagccag
ccttgggacaataatacaggctgtgcagacccctgctccctgatccccacacctgacaaa
gaagatgatgagcgggtttacccaaactcaacgtgcaagcctcggattattgcaccatcc
agaggctccccgctgcctgtactgagctgggcaaatagagaggaagtctggaaaatcatg
ttaaacaaggaaaagacatacttaagggatcagcactttcttgagcaacaccctcttctg
cagccaaaaatgcgagcaattcttctggattggttaatggaggtgtgtgaagtctataaa
cttcatagagagaccttttacttggcacaggatttctttgaccggtatatggcgacacaa
gaaaatgttgtgaaaactcttttacagcttattgggatttcatctttatttattgcagcc
aaacttgaggaaatctatcctccaaagttgcaccagtttgcgtatgtgacagatggagct
tgttcaggagatgaaattctcaccatggaattaatgattatgaaggcccttaagtggcgt
ttaagtcccctgactattgtgtcctggctgaatgtatacatgcaggttgcatatctaaat
gacttacatgaagtgctactgccgcagtatccccagcaaatctttatacagattgcagag
ctgttggatctctgtgtcctggatgttgactgcctcgaatttccttatggtatacttgct
gcttcagccttgtatcatttctcttcatctgaattgacacaaaaggtttcagggtatcag
tggtgcgacatagagaactgtgtcaagtggatggttccatttgccatggttataagggag
acggggagctcaaaactgaagcacttcaggggcgttgctgatgaagatgcacacaacata
cagacccacagagacagcttggacttgctggacaaagcccgagcaaagaaagccatgttg
tctgaacaaaatagggcttctcctctccccagtgggctcctcacccctccacagagcagt
aagaagcagagcagcgagccagaaatggcgtga

DBGET integrated database retrieval system