KEGG   Macaca mulatta (rhesus monkey): 700538
Entry
700538            CDS       T01028                                 

Gene name
PIP5K1B
Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 beta isoform X1
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00562  Inositol phosphate metabolism
mcc01100  Metabolic pathways
mcc04070  Phosphatidylinositol signaling system
mcc04072  Phospholipase D signaling pathway
mcc04144  Endocytosis
mcc04510  Focal adhesion
mcc04666  Fc gamma R-mediated phagocytosis
mcc04810  Regulation of actin cytoskeleton
mcc05135  Yersinia infection
mcc05231  Choline metabolism in cancer
Module
mcc_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    700538 (PIP5K1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    700538 (PIP5K1B)
   04072 Phospholipase D signaling pathway
    700538 (PIP5K1B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    700538 (PIP5K1B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    700538 (PIP5K1B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    700538 (PIP5K1B)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    700538 (PIP5K1B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    700538 (PIP5K1B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    700538 (PIP5K1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    700538 (PIP5K1B)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     700538 (PIP5K1B)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    700538 (PIP5K1B)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    700538 (PIP5K1B)
 Endosome - Golgi transport
  Others
   Others
    700538 (PIP5K1B)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 700538
NCBI-ProteinID: XP_014973338
Ensembl: ENSMMUG00000012472
UniProt: F7FF50
LinkDB
Position
15
AA seq 540 aa
MSSAAENGEAAPGKQNEEKTYKKTASSAIKGAIQLGIGYTVGNLTSKPERDVLMQDFYVV
ESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNP
GASGSLFFVTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCMQSGG
INIRIVVMNNVLPRSMRMHFTYDLKGSTYKRRASRKEREKSNPTFKDLDFLQDMHEGLYF
DTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHFLDHSLKEKEEETSQNVPDAKRPGMQ
KVLYSTAMESIQGPGKSGDGIITENPDTMGGIPAKSHRGEKLLLFMGIIDILQSYRLMKK
LEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSRVFKKIQALKASPSKKRCNSIAALKAT
SQEIVSSISQEWKDEKRDLLTEGQSFSSLDEEALGSRHRPDLVPSTPSLFEAASLATTIS
SSSLYVNEHYPHDRPTLYSNSKGLPSSSTFTLEEGTIYLTTEPNTLEVQDDNASVLDVYL
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgtcgtctgctgctgaaaatggagaggcagcacctggaaaacaaaatgaagaaaaaacc
tataaaaagactgcatcatctgctattaaaggtgctattcagctgggaataggatacacg
gtgggcaatctcacttccaagccagaacgagatgttcttatgcaagacttttatgtggtg
gaaagtgtgtttctacccagcgaagggagcaatctgaccccagcacatcactacccagac
tttagatttaagacatatgctccattagcattccgatatttcagagaactttttggtatc
aagcctgatgattacttgtattccatctgcagtgaacctctaatagaactgtctaaccct
ggagccagtggatccttgttttttgtgaccagtgatgatgaatttatcatcaaaacagtt
cagcacaaagaagctgagtttcttcagaagctcctgccgggctattacatgaatttaaac
cagaatccaaggactcttttgccaaaattttacggactgtattgtatgcaatcaggaggc
attaatatcaggattgtggtgatgaacaacgttttgccacgctccatgagaatgcacttt
acatatgacttgaaaggctcaacgtataagcggagagcatcccgtaaagagagagagaaa
tccaaccccacgtttaaggacttagacttcctgcaagacatgcacgaagggttgtatttt
gatacagaaacatacaacgcgcttatgaaaacactgcagagagactgccgggtgctggaa
agcttcaagatcatggactatagccttctgttgggaattcatttcctggaccattccctc
aaagagaaagaggaggagacctcacaaaatgtgcctgatgctaagcggcctgggatgcag
aaggttctctactcaacagccatggaatctatccagggtccagggaaatctggagatggg
atcatcacagagaacccagacacaatgggaggcattccagctaaaagccataggggagaa
aagctacttttatttatgggcattattgacattctacaatcgtataggttaatgaagaag
ttagaacattcctggaaagctcttgtttatgatggggacactgtttccgttcatagacca
agcttttatgcagacagatttctaaagttcatgaattccagagttttcaagaaaattcaa
gctttgaaggcctcaccttctaagaaacggtgcaattccatcgccgccttaaaggcgact
tcacaggagatcgtatcctcaattagccaggaatggaaggatgagaagcgagatttgctg
accgaaggacaaagttttagcagccttgatgaagaagccctgggatcccgacacaggcca
gacctggtgcctagcactccatcgctgtttgaagctgcttccttggcgaccacaatttca
tcttcttccttatacgtcaacgagcactatccacacgacaggcctacactctattcaaac
agcaaagggttaccttccagttcaacatttaccttggaagaggggaccatctacttgacc
actgaacccaacactctggaagtgcaggatgacaatgcttctgtgcttgatgtctattta
taa

KEGG   Macaca mulatta (rhesus monkey): 710007
Entry
710007            CDS       T01028                                 

Gene name
PIP5K1A
Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00562  Inositol phosphate metabolism
mcc01100  Metabolic pathways
mcc04070  Phosphatidylinositol signaling system
mcc04072  Phospholipase D signaling pathway
mcc04144  Endocytosis
mcc04510  Focal adhesion
mcc04666  Fc gamma R-mediated phagocytosis
mcc04810  Regulation of actin cytoskeleton
mcc05135  Yersinia infection
mcc05231  Choline metabolism in cancer
Module
mcc_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    710007 (PIP5K1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    710007 (PIP5K1A)
   04072 Phospholipase D signaling pathway
    710007 (PIP5K1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    710007 (PIP5K1A)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    710007 (PIP5K1A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    710007 (PIP5K1A)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    710007 (PIP5K1A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    710007 (PIP5K1A)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    710007 (PIP5K1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    710007 (PIP5K1A)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     710007 (PIP5K1A)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    710007 (PIP5K1A)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    710007 (PIP5K1A)
 Endosome - Golgi transport
  Others
   Others
    710007 (PIP5K1A)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 710007
NCBI-ProteinID: NP_001130039
Ensembl: ENSMMUG00000005228
UniProt: A0A1D5QPX6
LinkDB
Position
1
AA seq 550 aa
MASASSGPSSSVGFSSFDPAVPSCTSSSAASGIKRPVAPEVPYASGMPIKKIGHRSVDSS
GETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAH
HYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASGSLFYVSSDDEFI
IKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSV
KMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADMYNALCKTLQRDC
LVLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDTRRPAPQKALYSTAMESIQGEAR
RGGTMETDDHMGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVH
RPGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSGSSFSRRVGSSGNSCITYQPSVSGEHK
AQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPIVGETLQMLTTSTTLEK
LEVAESEFTH
NT seq 1653 nt   +upstreamnt  +downstreamnt
atggcgtcggcctcctccgggccgtcgtcttcggtcggtttttcatcctttgatcccgcg
gtcccttcctgtacctcgtcctcagcagcatctggaatcaagagacctgtggcacctgag
gtgccttatgcctctggcatgcccatcaagaaaataggccatcgaagtgttgattcctca
ggagagacaacatacaaaaagacaacttcatcagccttgaaaggtgccatccagttgggc
attacccacactgtggggagcctgagtaccaaaccagagcgtgatgtcctcatgcaagat
ttctacgtggtggagagtatcttcttccccagtgaagggagcaacctgacccctgctcat
cactacaatgactttcgtttcaagacctatgcacctgttgccttccgctacttccgggag
ctatttggtatccggcccgatgattacttgtattccctctgcagtgagccgctgattgaa
ctctgcagctctggagctagtggttcccttttctatgtgtccagtgatgatgagttcatt
attaagacagtccaacataaagaggcggagtttctgcagaagctgcttccaggatactac
atgaacctcaaccagaaccctcggactttgctgcctaaattctatggactgtactgtgtg
caggcaggtggcaagaacattcgaattgtggtgatgaacaatcttttaccaagatcggta
aaaatgcatatcaaatatgacctcaaaggctcaacctataaacggcgggcttcccagaaa
gagcgagagaagcctcttcccacatttaaagacctagacttcttacaagacatccctgat
ggtctttttttggatgctgacatgtacaacgctctctgtaagaccctgcagcgtgactgt
ttggtgctgcagagcttcaagataatggattatagcctcttgatgtcaatccataatata
gatcatgcacaacgagagcccttaagcagcgaaacacagtactcagttgacactcgaaga
ccagccccccaaaaggctctgtattccacagccatggaatccatccagggagaggctcga
cggggtggcaccatggagactgatgaccatatgggtggcatccctgcccggaatagtaaa
ggggaaaggcttctgctttatattggcatcattgacattctgcagtcttacaggtttgtt
aagaagttggagcactcttggaaagccctggtacatgacggggacactgtctcagtgcat
cgcccaggcttctacgctgaacggttccagcgcttcatgtgcaacacagtatttaagaag
attcccttgaagccttctccctccaaaaagtttcggtctggctcatctttctctcggcga
gtaggctccagtggcaactcctgcattacttaccaaccatcggtctctggggaacacaag
gcacaagtgacaacaaaggcggaagtggagccaggcgttcaccttggtcgtcctgatgtt
ttacctcagactccacctttggaggaaatcagtgagggctcacctattcctgaccccagt
ttctcacctatagttggagagactttgcaaatgctaactacaagtacaaccttggaaaag
cttgaagttgcagagtcagagttcacccattaa

KEGG   Macaca mulatta (rhesus monkey): 721744
Entry
721744            CDS       T01028                                 

Gene name
PIP5K1C
Definition
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 gamma isoform X1
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00562  Inositol phosphate metabolism
mcc01100  Metabolic pathways
mcc04070  Phosphatidylinositol signaling system
mcc04072  Phospholipase D signaling pathway
mcc04144  Endocytosis
mcc04510  Focal adhesion
mcc04666  Fc gamma R-mediated phagocytosis
mcc04810  Regulation of actin cytoskeleton
mcc05135  Yersinia infection
mcc05231  Choline metabolism in cancer
Module
mcc_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    721744 (PIP5K1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    721744 (PIP5K1C)
   04072 Phospholipase D signaling pathway
    721744 (PIP5K1C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    721744 (PIP5K1C)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    721744 (PIP5K1C)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    721744 (PIP5K1C)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    721744 (PIP5K1C)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    721744 (PIP5K1C)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    721744 (PIP5K1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    721744 (PIP5K1C)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     721744 (PIP5K1C)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    721744 (PIP5K1C)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    721744 (PIP5K1C)
 Endosome - Golgi transport
  Others
   Others
    721744 (PIP5K1C)
SSDB
Motif
Pfam: PIP5K Hemopexin
Other DBs
NCBI-GeneID: 721744
NCBI-ProteinID: XP_014977950
Ensembl: ENSMMUG00000008137
LinkDB
Position
19
AA seq 694 aa
MELEVPDEAESAEAGAVPSEAAWAAESGAAAGLAQKKAAPTEALSMTAQPGPGHGKKLGH
RGVDASGETTYKKTTSSTLKGAIQLGIGYTVGHLSSKPERDVLMQDFYVVESIFFPSEGS
NLTPAHHFQDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVT
SDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNN
ILPRVVKMHLKFDLKGSTYKRRASKKEKEKSFPTYKDLDFMQDMPEGLLLDADTFSALVK
TLQRDCLVLESFKIMDYSLLLGVHNIDQHERERQAQGARGTSDEKRPVGQKALYSTAMES
IQGGAARGEPIESDDTMGGIPAVNGRGERLLLHIGIIDILQSYRFIKKLEHTWKALVHDG
DTVSVHRPSFYAERFFKFMSNTVFRKNSSLKSSPSKKGRGGALLAVKPLGPTAAFSASQI
PSEREEAQYDLRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSP
SETSEQPRYRRRTQSSGQDGRPQEEPPAEEDLQQITVQVEPACSVEIVVPKEEDAGVEAS
MAGATAAVEAETASQASDEEGAPASQASDEEDTPATDIYFFTDGRYWIYSPHHRRLRAMT
LSASGTPTDERSWVYSPLHYSAQAPPASDGESDT
NT seq 2085 nt   +upstreamnt  +downstreamnt
atggagctggaggtgccggacgaggcggagagcgccgaggcgggggccgtgccctcggag
gcggcgtgggcggcggagagcggggcggcggcaggtttggctcagaagaaggcggcccca
acagaggccctgtcgatgacggcacagccaggccctggccatgggaagaagttgggccat
cgaggtgtggacgcatccggcgaaaccacctacaagaagaccacctcctctaccctgaag
ggcgccatccagctgggcatcggctacactgtaggccacctgagctccaagcccgagcgc
gatgtgctcatgcaggacttctacgtggtggagagcatcttcttccccagtgaaggcagc
aacctcacccccgcccaccacttccaggacttccgtttcaagacctatgcacctgtcgcc
ttccgctacttccgggagctcttcgggatccggccagacgattacttgtattccctgtgc
aatgagccgctgatcgagctgtccaacccgggtgccagcggctccctcttctacgtcacc
agcgacgacgagttcatcatcaagactgtcatgcacaaggaggccgagttcctgcagaag
ctgctccccggctactacatgaaccttaaccagaacccgcggacgctgctacccaagttc
tacgggctgtactgcgtgcagtcggggggcaagaacatccgcgtggtggtcatgaacaac
atcctgccccgcgtggtcaagatgcacctcaagttcgacctcaagggctccacctacaag
cggcgcgccagcaagaaggagaaggagaagagcttccccacctacaaggacctggacttc
atgcaggacatgcccgaggggctcctgctggacgccgacaccttcagcgccctggtcaag
acgctgcagcgggactgtctggtcctggagagcttcaagatcatggactacagcctactg
ctgggtgtgcacaacatcgaccagcacgagcgcgagcggcaggcgcagggcgcccggggc
acctcggacgagaagcggccagtaggccagaaggcgctctactccacggccatggagtcc
atccagggcggcgctgcgcgtggagaacccatcgagtcggatgacacgatgggcgggatc
cccgctgtgaacggccgcggggagcggctgctgctgcacattggcatcattgatatcctg
caatcctacaggttcatcaagaagctggagcacacctggaaggccctcgtccatgatggg
gatacggtgtctgtccaccgccccagcttctatgccgagcgctttttcaagttcatgagc
aacacagtctttcggaagaactcctccctgaagtcctcgccctccaagaaggggcgcggc
ggagccctgctggctgtgaaacccctggggcccacagctgccttctcggccagccaaatc
cccagcgagcgggaggaggcccagtacgacctgcggggggcccgcagctaccccacgctg
gaggacgaaggccggcctgaccttctgccctgcacgccaccttcttttgaagaagccact
acagcttccattgccaccactctgtcatccacatccctctccattcctgagcggtccccc
tcggagacttcggagcaacctcggtacaggcggcgcacacagtcctccggacaggatggc
aggccgcaggaggagccgcccgcagaagaggacctgcagcagattacagtgcaggtggag
cctgcgtgcagtgtggagatcgtggtccccaaagaggaggacgcaggggtggaggcttcc
atggccggtgccactgccgctgttgaagcagaaactgccagccaggcctcggacgaggag
ggcgcacccgccagccaggcctcggacgaggaggacacgcccgccactgacatctacttt
ttcacggatgggaggtactggatttactctccccaccatcgccgactgcgggccatgacg
ctgagcgcctcagggactcccaccgatgagaggagctgggtgtactccccactccactat
agcgcccaggcccccccggcctccgacggcgagagcgacacataa

DBGET integrated database retrieval system