KEGG   Macaca mulatta (rhesus monkey): 700634
Entry
700634            CDS       T01028                                 

Gene name
PTK2
Definition
(RefSeq) focal adhesion kinase 1 isoform X8
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04012  ErbB signaling pathway
mcc04062  Chemokine signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04510  Focal adhesion
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc04935  Growth hormone synthesis, secretion and action
mcc05100  Bacterial invasion of epithelial cells
mcc05135  Yersinia infection
mcc05146  Amoebiasis
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05205  Proteoglycans in cancer
mcc05222  Small cell lung cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    700634 (PTK2)
   04370 VEGF signaling pathway
    700634 (PTK2)
   04151 PI3K-Akt signaling pathway
    700634 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    700634 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    700634 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    700634 (PTK2)
   04062 Chemokine signaling pathway
    700634 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    700634 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    700634 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    700634 (PTK2)
   05202 Transcriptional misregulation in cancer
    700634 (PTK2)
   05205 Proteoglycans in cancer
    700634 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    700634 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    700634 (PTK2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    700634 (PTK2)
   05100 Bacterial invasion of epithelial cells
    700634 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    700634 (PTK2)
   05163 Human cytomegalovirus infection
    700634 (PTK2)
   05165 Human papillomavirus infection
    700634 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    700634 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    700634 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    700634 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    700634 (PTK2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     700634 (PTK2)
Protein kinases [BR:mcc01001]
 Non-receptor tyrosine kinases
  FAK family
   700634 (PTK2)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     700634 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 700634
NCBI-ProteinID: XP_015001550
Ensembl: ENSMMUG00000002336
LinkDB
Position
8
AA seq 1116 aa
MLLELAGQEALKPAGAIYMEKSGCSPFPVCWAKEYDRYLASSKIMAAAYLDPNLNHTPNS
STKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHK
VKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQ
FTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEV
LEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKE
CFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGML
QLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGASQSFIIRPQKEGERALPSIPKL
ANSEKQGMRTHAVSVSGVSHCQHKVKKARRFLPLVFCSHDPPSTDEISGDETDDYAEIID
EEDTYTMPSKSYGIDEARDYEIQRERIELGRCIGEGQFGDVHQGVYMSPENPALAVAIKT
CKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRK
YSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDST
YYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRI
ENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQQEERMRMES
RRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITA
MAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTALDLRGIGQVLPTHLMEERLIRQ
QQEMEEDQRWLEKEERFLIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPAD
SYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKE
VGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEY
KKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
NT seq 3351 nt   +upstreamnt  +downstreamnt
atgttgttggaactggcaggccaagaggccctgaaaccagcaggtgccatctatatggag
aaaagcggctgtagtccatttccagtgtgttgggctaaagaatatgacagatacctagca
tctagcaaaataatggcagctgcttaccttgaccccaacttgaatcacacaccaaattcg
agtactaagactcacctgggtactggtatggaacgttctcctggtgcgatggagcgagta
ttaaaggtctttcattattttgaaagcaatagtgagccaaccacctgggccagtattatc
aggcatggagatgctactgatgtcaggggcatcattcagaagatagtggacagtcacaaa
gtaaagcatgtggcctgctatggattccgcctcagtcacctgcggtcagaggaggttcac
tggcttcacgtggatatgggcgtctccagtgtgagggagaagtatgagcttgcccaccca
ccagaggagtggaaatatgaattgagaattcgttatttgccaaaaggatttctaaaccag
tttactgaagataagccaactttgaatttcttctatcaacaggtgaagagcgattatatg
ttagagatagctgatcaagtggaccaggaaattgctttgaagttgggttgtctagaaata
cggcgatcatactgggagatgcggggcaatgccctagaaaagaagtctaactatgaagta
ttagaaaaagatgttggtttaaagcgattttttcctaagagtttactggattctgtcaag
gccaaaacactaagaaaactgatccaacaaacatttagacaattcgccaaccttaataga
gaagaaagtattctgaaattctttgagatcctgtctccagtctacagatttgataaggaa
tgcttcaagtgtgctcttggttcaagctggattatttcagtggaattggcaatcggccca
gaagaagggatcagttacctaacggacaagggctgcaatcccacacatcttgctgacttc
actcaagtgcagaccattcagtattcaaacagtgaagataaggacagaaaaggaatgcta
caactaaaaatagcaggtgcacccgagcctctgacagtgacggcaccatccctaaccatt
gcggagaatatggctgacctgatagatgggtattgccggctggtgaatggagcctcgcag
tcatttatcatcagaccccagaaagaaggtgaacgggctttgccatcaataccaaagttg
gccaacagcgaaaagcaaggcatgcggacacacgccgtctctgtgtcaggagtcagtcac
tgccaacataaagttaagaaagctaggcgctttctccctttggtcttctgttcccatgat
cctccttctacggatgaaattagtggggacgaaacagatgattatgctgagattatagat
gaagaagatacttacaccatgccctcaaaaagctatggaatagatgaagccagggattat
gagattcaaagagaaagaatagaacttggacgatgtattggagaaggccaatttggagat
gtacatcaaggcgtttatatgagtccagagaatccagctttggcggttgcaattaaaaca
tgtaaaaactgtacttcggacagcgtgagagagaaatttcttcaagaagccttaacaatg
cgtcagtttgaccatcctcatattgtgaagctgattggagtcatcacagagaatcctgtc
tggataatcatggagctgtgcacacttggagagctgaggtcgtttttgcaagtaaggaaa
tacagtttggatctagcatctttgatcctgtatgcctatcagcttagtacagctcttgca
tatctagagagcaaaagatttgtacacagggacattgctgctcggaatgttctggtgtcc
tcaaatgattgtgtaaaattaggagactttggattatcccgatatatggaagatagtact
tactacaaagcttccaaaggaaaattgcctattaaatggatggctccagagtcaatcaat
tttcgacgttttacctcagctagtgacgtatggatgtttggtgtgtgtatgtgggagata
ctgatgcatggtgtgaagccttttcaaggagtgaagaacaatgatgtaatcggtcgaatt
gaaaatggggaaagattaccaatgcctccaaattgtcctcctaccctctacagccttatg
acgaaatgctgggcctatgaccccagcaggcggcccaggtttactgaacttaaagctcag
ctcagcacaatcctggaggaagagaaggctcagcaagaagaacgcatgaggatggagtcc
agaagacaggccacagtgtcctgggactccggagggtctgatgaagcgccacccaagccc
agcagaccgggttatcctagtccgaggtccagcgaaggattttatcccagcccacagcac
atggtacaaaccaatcattaccaggtttctggctaccctggttcacatggaatcacagcc
atggctggcagcatctatccaggtcaggcatctcttttggaccaaacagattcatggaat
catagacctcaggagatagcaatgtggcagcccaatgtggaggactctacagcattggac
ctgcgagggattgggcaagtgttgccaacccacctgatggaagagcggctaatccgacag
caacaggaaatggaagaagatcagcgctggctggaaaaagaggaaagatttctgattgga
aaccaacatatatatcagcctgtgggtaaaccagatcctgcagctccaccaaagaaaccg
cctcgccctggagctcccggtcacctgggaagccttgccagcctcagcagccctgctgac
agctacaacgagggtgtcaagcttcagccccaggaaatcagcccccctcctactgccaac
ctggaccggtcaaatgataaggtgtacgagaatgtgacgggcctggtgaaagctgtcatc
gagatgtccagtaaaatccagccagccccaccagaggagtatgtccctatggtgaaggaa
gtcggcttggccctgaggacgttattggccactgtggatgagaccattcccctcctacca
gccagcacccaccgagagattgagatggcacagaaactattaaactctgacctgggtgag
ctcatcaacaagatgaaactggcccagcagtatgtcatgaccagtctccagcaagagtac
aaaaagcaaatgctgactgctgctcacgccctggctgtggatgccaaaaacttactcgat
gtcattgaccaagcaagactgaaaatgcttgggcagacgagaccacactga

DBGET integrated database retrieval system