KEGG   Macaca mulatta (rhesus monkey): 700731
Entry
700731            CDS       T01028                                 

Gene name
FOXO3
Definition
(RefSeq) forkhead box protein O3
  KO
K09408  forkhead box protein O3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04062  Chemokine signaling pathway
mcc04068  FoxO signaling pathway
mcc04137  Mitophagy - animal
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04218  Cellular senescence
mcc04722  Neurotrophin signaling pathway
mcc04917  Prolactin signaling pathway
mcc05213  Endometrial cancer
mcc05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    700731 (FOXO3)
   04151 PI3K-Akt signaling pathway
    700731 (FOXO3)
   04152 AMPK signaling pathway
    700731 (FOXO3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    700731 (FOXO3)
  09143 Cell growth and death
   04218 Cellular senescence
    700731 (FOXO3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    700731 (FOXO3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    700731 (FOXO3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    700731 (FOXO3)
  09149 Aging
   04211 Longevity regulating pathway
    700731 (FOXO3)
   04213 Longevity regulating pathway - multiple species
    700731 (FOXO3)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    700731 (FOXO3)
   05223 Non-small cell lung cancer
    700731 (FOXO3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    700731 (FOXO3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    700731 (FOXO3)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    700731 (FOXO3)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 700731
NCBI-ProteinID: XP_001093593
Ensembl: ENSMMUG00000020369
UniProt: F6UMX8
LinkDB
Position
4
AA seq 672 aa
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEE
EDDEDDEDGGGRAGSAMAIGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGALSG
GTQALLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLS
QIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGG
KSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSSD
ELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSSSASLSPSVNKP
CTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGS
GLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSH
SDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQ
GALGGSRALSNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLPV
MGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTG
AKQASSQSWVPG
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggcagaggcaccggcctccccggccccgctctctccgctggaagtggagctggacccg
gagttcgagccccagagccgtccgcgctcctgtacgtggcccctgcaaaggccggagctc
caagcgagccctgctaagccctcgggggagacggccgccgactccatgatccccgaggag
gaggacgatgaagacgacgaggacggcgggggacgggccggctcggccatggcgatcggc
ggcggcgggagcggcacgctgggctccgggctgctccttgaggactcggcccgggtgctg
gcacccggagggcaagaccccgggtctgggccagccaccgcggcgggcgctctgagcggg
ggtacacaggcgctgctgcagcctcagcagccgctgccaccgccgcagccgggggcggct
gggggctccgggcagccgaggaaatgctcgtcgcggcggaacgcctggggaaacctgtcc
tacgcggacctgatcacccgcgccatcgaaagctccccggacaaacggctcactctgtcc
cagatctacgagtggatggtgcgttgcgtgccctacttcaaggataagggcgacagcaac
agctctgccggctggaagaactccatccggcacaatctgtcgctgcatagtcgattcatg
cgggtccagaatgagggaactggcaagagctcttggtggatcatcaacccggatgggggg
aagagcggaaaagccccccggcggcgggctgtctccatggacaacagcaacaagtatacc
aagagccgtggccgcgcagccaagaagaaggcagccctgcagacagcccctgaatcagct
gacgacagtccctcccagctctccaagtggcctggcagccccacgtcacgcagcagtgat
gagctggatgcgtggacggacttccgttcacgcaccaattctaacgccagcacagtcagt
ggccgcctgtcgcccatcatggcaagcacagagttggatgaagtccaggacgacgatgca
cctctctcgcccatgctctacagcagctcagccagcctgtcaccttcagtgaacaagcca
tgcacggtggaactgccacggctgactgatatggcaggcaccatgaatctgaatgatggg
ctgactgagaacctcatggacgacctgctggataacatcacgctcccgccatcccagcca
tcacccactgggggacttatgcagcggagctctagcttcccatacaccaccaagggctcg
ggcctgggctccccaaccagctccttcaacagcacggtgtttggaccttcatctctgaac
tccctacgccagtctcccatgcagaccatccaagagaacaagccagctaccttctcttcc
atgtcacactatggtaaccagacactccaggacctgctcacttcggactcacttagccac
agcgatgtcatgatgacacagtcggaccccttgatgtctcaggccagcaccgctgtgtct
gcccagaattcccgccggaacgtgatgcttcgcaatgacccaatgatgtcctttgctgcc
cagcctaaccagggaagtttggtcaatcagaacttgctccaccaccagcaccaaacccag
ggcgctcttggtggcagccgtgccttgtcgaattctgtcagcaacatgggcttgagtgag
tccagcagccttgggtcagccaaacaccagcagcagtctcctgtcagccagtctatgcaa
accctctcggactctctctcaggctcctccttgtactcaactagtgcaaacctgcccgtc
atgggccatgagaagttccccagcgacttggacctggacatgttcaatgggagcttggaa
tgtgacatggagtccattatccgtagcgaactcatggatgctgatgggttggattttaac
tttgattccctcatctccacacagaatgttgttggtttgaacgtggggaacttcactggt
gctaagcaggcctcatctcagagctgggtgccaggctga

DBGET integrated database retrieval system