KEGG   Macaca mulatta (rhesus monkey): 700788
Entry
700788            CDS       T01028                                 

Gene name
DOCK1
Definition
(RefSeq) dedicator of cytokinesis protein 1 isoform X1
  KO
K13708  dedicator of cytokinesis protein 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04510  Focal adhesion
mcc04666  Fc gamma R-mediated phagocytosis
mcc04810  Regulation of actin cytoskeleton
mcc05100  Bacterial invasion of epithelial cells
mcc05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    700788 (DOCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    700788 (DOCK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    700788 (DOCK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    700788 (DOCK1)
   05100 Bacterial invasion of epithelial cells
    700788 (DOCK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    700788 (DOCK1)
Membrane trafficking [BR:mcc04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    700788 (DOCK1)
SSDB
Motif
Pfam: DHR-2 DOCK_N DOCK-C2
Other DBs
NCBI-GeneID: 700788
NCBI-ProteinID: XP_028682831
Ensembl: ENSMMUG00000018547
LinkDB
Position
9
AA seq 1531 aa
MFRSVRHMIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNI
LDPELTSTISLFRAHEIASKQVEERLQEEKSQKQNIDINRQAKFAATPSLALFVNLKNVV
CKIGEDAEVLMSLYDPVESKFISENYLVRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKRE
KISFVCQIVRVGRMELRDNNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQP
LALDDAIRHKPLNMSSRFSPRVAGENDFLQTVINKVIAAKEVNHKGQGLWVTLKLLPGDI
HQIRKEFPHLVDRTTAVARKTGFPEIIMPGDVRNDIYVTLVQGDFDKGSKTTAKNVEVTV
SVYDEDGKRLEHVIFPGAGDEAISEYKSVIYYQVKQPRWFETVKVAIPIEDVNRSHLRFT
FRHRSSQDSKDKSEKIFALAFVKLMRYDGTTLRDGEHDLIVYKAEAKKLEDAATYLSLPS
TKAELEEKGHSATGKSMQSLGSCTISKDSFQISTLVCSTKLTQNVDLLGLLKWRSNTSLL
QQNLRQLMKVDGGEVVKFLQDTLDALFNIMMENSESETFDTLVFDALVFIIGLIADRKFQ
HFNPVLETYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVNEQLYKAMKALESIFKFIVRS
RILFNQLYENKGEADFVESLLQLFRSINDMMSSMSDQTVRVKGAALKYLPTIVNDVKLVF
DPKELSKMFTEFILNVPMGLLTIQKLYCLIEIVHSDLFTQHDCREILLPMMTDQLKYHLE
RQEDLEACCQLLSHILEVLYRKDVGPTQRHVQIIMEKLLRTVNRTVISMGRDSELIGNFV
ACMTAILRQMEDYHYAHLIKTFGKMRTDVVDFLMETFIMFKNLIGKNVYPFDWVIMNMVQ
NKVFLRAINQYADMLNKKFLDQANFELQLWNNYFHLAVAFLTQESLQLENFSSAKRAKIL
NKYGDMRRQIGFEIRDMWYNLGQHKIKFIPEMVGPILEMTLIPETELRKATIPIFFDMMQ
CEFHSTRSFQMFENEIITKLDHEVEGGRGDEQYKVLFDKILLEHCRKHKYLAKTGETFVK
LVVRLMERLLDYRTIMHDENKENRMSCTVNVLNFYKEIEREEMYIRYLYKLCDLHKECDN
YTEAAYTLLLHAKLLKWSEDVCVAHLTQRDGYQATTQGQLKEQLYQEIIHYFDKGKMWEE
AIALGKELAEQYENEMFDYEQLSELLKKQAQFYENIVKVIRPKPDYFAVGYYGQGFPTFL
RGKVFIYRGKEYERREDFEARLLTQFPNAEKMKTTSPPGDDIKNSPGQYIQCFTVKPKLD
LPPKFHRPVSEQIVSFYRVNEVQRFEYSRPIRKGEKNPDNEFANMWIERTIYTTAYKLPG
ILRWFEVKSVFMVEISPLENAIETMQLTNDKINSMVQQHLDDPSLPINPLSMLLNGIVDP
AVMGGFTNYEKAFFTDRYLQEHPEAHEKIEKLKDLIAWQIPFLAEGIRIHGDKVTEALRP
FHERMEACFKQLKEKVEKEYGVRIMVRGSYG
NT seq 4596 nt   +upstreamnt  +downstreamnt
atgtttcgaagtgtgcggcacatgatctatgaccttattgaatggcgatcacaaattctt
tctggaactctgccgcaggatgagctcaaagaactgaagaagaaggtcacagccaaaatt
gattatggaaacagaattctagatttggacctggtggttagagatgaagacgggaatatt
ttggatccagaattaactagcacgattagtctcttcagagctcatgaaatagcttctaaa
caagtggaggaaaggttacaagaagaaaagtctcaaaagcagaacatagatattaacaga
caagccaagtttgctgcaaccccttctctggccttgtttgtgaacctcaaaaacgtggtt
tgtaaaataggagaagatgcggaagtcctcatgtctctgtatgatcctgtggagtccaag
ttcatcagtgaaaactacctggttcgctggtccagttcaggattacctaaagacatagac
agattacataatttgcgagctgtgtttactgacctcggaagcaaagacctgaaaagggag
aaaatcagttttgtctgtcagattgttcgcgtgggtcgcatggagctgagggacaacaat
accaggaaactgacttcggggttgcggcgaccttttggagtggctgtgatggatgtaaca
gatataataaatggaaaagtagacgacgaagataagcagcatttcattccctttcagccg
ctcgcgttggacgacgccattcgacacaagccgctgaacatgtcatcccgtttttcaccc
agggtggcaggggagaatgacttccttcagactgttataaacaaagtcatcgctgccaaa
gaagtcaaccacaaggggcagggtttgtgggtaacactgaaattacttcctggagatatc
catcagatccgaaaagagtttccgcatttagtggacaggaccacagctgtggctcgaaaa
acagggtttccggagataatcatgcctggtgatgttcgaaatgatatctatgtaacatta
gttcaaggggattttgataaaggaagcaaaacaacagcaaagaacgtggaggtcacggtg
tcggtgtatgatgaagatgggaaacgattagagcatgtgattttcccgggagctggtgat
gaagcgatttcagagtacaaatctgtgatttactaccaagtaaagcagccacgctggttt
gagactgttaaggtggccattcccatagaggacgttaaccgcagtcaccttcggtttacc
ttccgccacaggtcatcacaggactctaaggataaatctgagaagatatttgcactagca
tttgtcaagctgatgagatatgatggtaccaccctgcgagacggagagcatgatcttatc
gtctataaggccgaagcgaagaagctggaagacgcagccacgtacttgagtctgccctcc
acgaaggccgagttggaagaaaagggccactcggccacgggcaagagtatgcagagcctt
gggagctgcaccattagcaaggactccttccagatctccacgctcgtgtgctccaccaaa
ctgacccagaacgtggaccttctggggctcttgaagtggcgctccaacaccagcctgctg
cagcagaacttgaggcagctgatgaaggtcgatggtggtgaagtagtgaagtttcttcag
gacacgttggatgccctcttcaacatcatgatggagaactcggagagtgagacttttgac
acattggtctttgatgctctggtatttatcattggactgattgctgatagaaaatttcag
cattttaatcctgttttggaaacttacattaagaagcactttagtgcaactttagcctac
acgaagctgacaaaagtgttgaagaactacgtggacggtgctgagaagccgggagtaaac
gagcagctgtacaaagccatgaaagcgctggagtccatcttcaagttcatcgtgcgctcc
aggatcctgttcaatcaactgtatgaaaacaagggagaggccgactttgtggaatctttg
ctgcagctcttcaggtccatcaatgacatgatgagcagcatgtcagaccagaccgtccgg
gtgaagggggcagcactgaaatacttaccaacgatcgtcaacgatgtgaaattggtgttt
gatcccaaagagctcagcaaaatgtttactgaattcatcctcaatgttcccatgggcttg
ctgaccatccagaaactttactgcctgatcgaaatcgtccacagtgacctcttcacacag
catgactgcagagagatcctgcttcccatgatgaccgatcagctcaagtaccatctggag
agacaggaggacctggaggcctgctgtcagctgctcagccacatcctggaggtgctatac
aggaaggacgtggggccgactcagagacacgtccagattatcatggagaaacttctccgg
actgtgaaccgaaccgtcatttccatgggacgagattccgaactcattggaaacttcgtg
gcttgcatgacagctattttacgacaaatggaggattaccattatgcccacttgatcaag
actttcgggaaaatgaggactgatgtggtagatttcctaatggaaacattcatcatgttt
aagaacctcattggaaagaacgtttaccccttcgactgggtgatcatgaacatggtgcaa
aataaagtcttcctgcgagcaattaatcagtatgcagatatgctgaacaaaaaatttctg
gatcaagccaactttgagctacagctgtggaacaactactttcacctggctgttgctttc
cttactcaagagtccctgcaactggagaatttttcaagtgccaagagagccaaaatcctt
aacaagtacggagatatgaggagacagattggctttgaaatcagagacatgtggtacaac
cttggtcaacacaagataaagttcattccagaaatggtgggcccaatattagaaatgacg
ttaattcccgagacggagctgcgcaaagccaccatccccatcttctttgatatgatgcag
tgtgaatttcattcgacccgaagcttccaaatgtttgaaaatgagatcatcaccaagctg
gatcatgaagtggaaggaggcagaggagacgaacagtacaaagtgttatttgataaaatc
cttctggagcactgcaggaagcataaatacctcgccaaaacaggagaaacttttgtaaaa
ctcgttgtgcgcttaatggaaaggcttttggattatagaaccatcatgcacgacgagaac
aaagaaaaccgcatgagctgcaccgtcaatgtgctgaatttctacaaagaaattgaaaga
gaagaaatgtacataaggtatttgtacaagctctgtgacctgcacaaggagtgtgataac
tacaccgaggcggcctacaccttgcttctccatgcaaagcttcttaagtggtcggaggat
gtgtgtgtggcccacctcacccagcgggacgggtaccaggccaccacgcagggacagctg
aaggagcagctctaccaggaaatcatccactacttcgacaaaggcaagatgtgggaggag
gccattgccttgggcaaggagctagccgagcagtatgagaacgaaatgtttgattatgag
caactcagcgaattgctgaaaaaacaggctcagttttatgaaaacatcgtcaaagtgatc
aggcccaagcctgactattttgctgttggctactacggacaagggttccccacattcctg
cggggaaaagttttcatttaccgagggaaagagtatgagcgccgggaagattttgaggct
cgactgttaactcagtttccaaacgccgagaaaatgaagacaacatctccaccaggcgac
gatattaaaaactcccctggccagtatattcagtgcttcacagtgaagcccaaactcgat
ctgcctcctaagtttcacaggccagtgtcagagcagattgtaagtttttacagggtgaac
gaggtccagcgatttgaatattctcggccaatccggaaaggagagaaaaacccagacaat
gaatttgcgaatatgtggatcgagagaaccatatacacaactgcatataaattacctgga
attttaaggtggtttgaggtcaagtctgttttcatggtggaaatcagccccctggagaac
gccatcgagaccatgcagctgacgaacgacaagatcaacagcatggtgcagcagcacctg
gatgaccccagcctgcccatcaacccactctccatgctcctgaacggcatcgtggaccca
gctgtcatggggggcttcacaaactacgaaaaggccttctttacagaccggtacctgcag
gagcaccctgaggcccatgaaaagatcgagaagctcaaggatctgattgcgtggcagatt
ccttttctggccgaagggatcagaatccatggagacaaagtcacggaggcactgaggccg
ttccacgagaggatggaggcctgtttcaaacagctgaaggaaaaagtggagaaagagtat
ggcgtccgaatcatggtaagagggtcgtatgggtag

DBGET integrated database retrieval system