KEGG   Macaca mulatta (rhesus monkey): 700942
Entry
700942            CDS       T01028                                 

Gene name
TANK
Definition
(RefSeq) TRAF family member-associated NF-kappa-B activator
  KO
K12650  TRAF family member-associated NF-kappa-B activator
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04140  Autophagy - animal
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc05014  Amyotrophic lateral sclerosis
mcc05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    700942 (TANK)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    700942 (TANK)
   04622 RIG-I-like receptor signaling pathway
    700942 (TANK)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    700942 (TANK)
   05022 Pathways of neurodegeneration - multiple diseases
    700942 (TANK)
SSDB
Motif
Pfam: TBD FliD_N PspA_IM30 DUF3713 MRF_C1 AAA_13
Other DBs
NCBI-GeneID: 700942
NCBI-ProteinID: NP_001244472
Ensembl: ENSMMUG00000001680
UniProt: A0A1D5RCA1
LinkDB
Position
12
AA seq 425 aa
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKS
QLLLVNSTQDGNYGCVPLLEDSETRKNNLTVDQPHNKVISGIAKEKLPKVRRQEVSSPRK
ETSARSLGSPLLHERGSIEKTFWDLKEEFHRICMLAKAQKDHLSKLNIPDTATETQCSVP
IQCTDKTDKQEALFKPQAKDDINRGAPSITCVTPRGLCRDEEDTSFESLSKFNVKFPPMD
NDSTFLHSTPERPGILSPATSEAMCQEKFNTEFRDNPGNFVKTEETLFEIQGIDPIASAI
QNLKTTDKTKPSNLVNTCIRTTLDRAACLPPGDHNALYVNTFPLLDPSDAPFPSLDSPGK
AIRGPQQPIWKPFPNQNSDSVVLSGTDSELHIPRVCEFCQAVFPPSITSRGDFLRHLNSH
FNGET
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggataaaaacattggcgagcaactcaataaagcatatgaagccttccggcaggcatgc
atggatagagattctgcagtgaaagaattacagcaaaagactgagaactatgagcagaga
atacgtgaacaacaggaacagctgtcacttcaacaaactattattgacaagctaaaatca
cagttacttcttgtgaattccactcaagatggcaattatggctgtgttcctctgcttgaa
gacagtgaaacaaggaagaataatttgactgttgatcagccacataataaagtgatttca
ggaatagcaaaggaaaaactaccaaaggtaagaagacaagaggtttcttctcctagaaaa
gaaacttcagcaaggagtcttggcagtcctttgctccatgaaaggggtagtatagagaag
actttctgggatctgaaagaagaatttcatagaatatgcatgctagcaaaagcacagaaa
gaccacttaagcaaacttaatataccagacactgcaactgagacacagtgctctgtgcct
atacagtgtacggataaaacagataaacaagaggcgctgtttaagcctcaggctaaagat
gatataaatagaggtgcaccatccatcacatgtgtcacaccaagaggactgtgcagagat
gaggaagacacctcttttgaatcactttctaaattcaatgtcaagtttccacctatggac
aatgactcgactttcttacatagcactccagagagacccggcatccttagtcctgccacg
tctgaggcaatgtgccaagagaaatttaatacggagttcagagacaacccagggaacttt
gttaaaacagaagaaactttatttgaaattcagggaattgaccccatagcttcagctata
caaaaccttaaaacaactgacaaaacaaagccctcaaatcttgtaaacacttgtatcagg
acaactctggatagagctgcgtgtttgccacctggagaccataatgcattatatgtaaat
accttcccacttctggacccatctgatgcaccttttccctcacttgattccccaggaaaa
gctatccgaggaccacagcagcccatttggaagccctttcctaatcaaaacagtgactcg
gtggtactaagtggcacagactcagaactgcatatacctcgagtatgtgaattctgtcaa
gcagttttcccaccatccattacatccagaggggatttccttcggcatcttaattcacac
ttcaatggagagacttaa

DBGET integrated database retrieval system