KEGG   Macaca mulatta (rhesus monkey): 701057
Entry
701057            CDS       T01028                                 

Gene name
SRC
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc04012  ErbB signaling pathway
mcc04015  Rap1 signaling pathway
mcc04062  Chemokine signaling pathway
mcc04137  Mitophagy - animal
mcc04144  Endocytosis
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04530  Tight junction
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04613  Neutrophil extracellular trap formation
mcc04625  C-type lectin receptor signaling pathway
mcc04727  GABAergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04810  Regulation of actin cytoskeleton
mcc04912  GnRH signaling pathway
mcc04915  Estrogen signaling pathway
mcc04917  Prolactin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04926  Relaxin signaling pathway
mcc05100  Bacterial invasion of epithelial cells
mcc05135  Yersinia infection
mcc05152  Tuberculosis
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05203  Viral carcinogenesis
mcc05205  Proteoglycans in cancer
mcc05219  Bladder cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    701057 (SRC)
   04015 Rap1 signaling pathway
    701057 (SRC)
   04370 VEGF signaling pathway
    701057 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    701057 (SRC)
   04137 Mitophagy - animal
    701057 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    701057 (SRC)
   04520 Adherens junction
    701057 (SRC)
   04530 Tight junction
    701057 (SRC)
   04540 Gap junction
    701057 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    701057 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    701057 (SRC)
   04613 Neutrophil extracellular trap formation
    701057 (SRC)
   04625 C-type lectin receptor signaling pathway
    701057 (SRC)
   04062 Chemokine signaling pathway
    701057 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    701057 (SRC)
   04915 Estrogen signaling pathway
    701057 (SRC)
   04917 Prolactin signaling pathway
    701057 (SRC)
   04921 Oxytocin signaling pathway
    701057 (SRC)
   04926 Relaxin signaling pathway
    701057 (SRC)
   04919 Thyroid hormone signaling pathway
    701057 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    701057 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    701057 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    701057 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    701057 (SRC)
   05203 Viral carcinogenesis
    701057 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    701057 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    701057 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    701057 (SRC)
   05152 Tuberculosis
    701057 (SRC)
   05100 Bacterial invasion of epithelial cells
    701057 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    701057 (SRC)
   05168 Herpes simplex virus 1 infection
    701057 (SRC)
   05163 Human cytomegalovirus infection
    701057 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    701057 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    701057 (SRC)
   01522 Endocrine resistance
    701057 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    701057 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    701057 (SRC)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     701057 (SRC)
Protein kinases [BR:mcc01001]
 Non-receptor tyrosine kinases
  SRC family
   701057 (SRC)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    701057 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    701057 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    701057 (SRC)
  Macropinocytosis
   Kinases
    701057 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3
Other DBs
NCBI-GeneID: 701057
NCBI-ProteinID: NP_001248263
Ensembl: ENSMMUG00000020131
UniProt: I0FJ06
LinkDB
Position
10
AA seq 536 aa
MGSNKSKPKDASQRRRSLEPAENAHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggatgccagccagcggcgccgcagcctggagccc
gccgagaacgcgcatggcgctggcgggggcgctttccccgcctcccagacccccagcaag
ccagcctcggccgacggccaccgcggccccagcgcggccttcgcccccgcggccgccgag
cccaagctgttcggaggcttcaactcctcggacaccgtcacctccccgcagagggcgggc
ccgctggccggtggagtgaccacctttgtggccctctatgactatgagtctaggacggag
acagacctgtccttcaagaaaggcgagcggctccagattgtcaacaacacagagggagac
tggtggctggcccactcgctcagcacgggacagacaggctacattcccagcaactacgtg
gcgccctccgactccatccaggccgaggagtggtattttggcaagatcaccagacgggag
tcagagcggttactgctcaatgcggagaacccgagagggaccttcctcgtgcgagaaagt
gagaccacaaaaggtgcctactgcctctcagtgtccgacttcgacaacgccaagggcctc
aacgtgaagcactacaagatccgcaagctggacagcggcggcttctacatcacctcccgc
acccagttcaacagcctgcagcagctggtggcctactactccaaacacgccgatggcctg
tgccaccgcctcaccactgtgtgccccacatccaagcctcagactcagggcctggccaag
gatgcctgggagatccctcgggagtcgctgcggctggaggtcaagctgggccagggctgc
tttggcgaggtgtggatggggacctggaacggcactaccagggtggccatcaaaaccctg
aagcctggcacgatgtctccagaggccttcctgcaggaggcccaggtcatgaagaagctg
aggcatgagaagctggtgcagttgtatgctgtggtttcggaggagcccatttacatcgtc
acagagtacatgagcaaggggagtttgctggactttctcaagggggagacgggcaagtac
ctgcggctacctcagctggtggacatggctgctcagatcgcctcaggcatggcatacgtg
gagcggatgaactacgtccaccgggatcttcgtgcagccaacatcctggtgggagagaac
ctggtgtgcaaagtggctgacttcgggctggctcggctcatcgaagacaatgagtacacg
gcccggcaaggtgccaaattccccatcaagtggacagctccggaagctgccctgtatggc
cgcttcaccatcaagtcggacgtgtggtcctttgggatcctgctgactgagctcaccaca
aagggacgggtgccctaccctgggatggtgaaccgcgaggtgctggaccaggtggaacgg
ggctaccggatgccctgcccaccggagtgtcccgagtccctgcacgacctcatgtgccag
tgctggcggaaggagcctgaggagcggcccaccttcgagtacctgcaggccttcctggag
gactacttcacgtccaccgagcctcagtaccagcccggggagaacctctag

DBGET integrated database retrieval system