KEGG   Macaca mulatta (rhesus monkey): 701157
Entry
701157            CDS       T01028                                 

Gene name
ZEB1
Definition
(RefSeq) zinc finger E-box-binding homeobox 1 isoform X1
  KO
K09299  zinc finger homeobox protein 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05202  Transcriptional misregulation in cancer
mcc05206  MicroRNAs in cancer
mcc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    701157 (ZEB1)
   05206 MicroRNAs in cancer
    701157 (ZEB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    701157 (ZEB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    701157 (ZEB1)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    701157 (ZEB1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-met zf-Di19 zf-C2H2_jaz Homeodomain zf-C2H2_6 zf-C2HE zf-C2H2_2
Other DBs
NCBI-GeneID: 701157
NCBI-ProteinID: XP_015002241
Ensembl: ENSMMUG00000015453
UniProt: I0FUL9
LinkDB
Position
9
AA seq 1126 aa
MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDD
LPTDQTVLPGRSSEREGNAKNCWEDDTGKEGQEILGPEAQADEAGCTVKDDECESDAENE
QNHDPNVEEFLQQQDTAVIFPEAPEEDQRQGTPEASGHDENGTPDAFSQLLTCPYCDRGY
KRFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRK
FKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVN
GRPRTGLKTSQCSSPSLSASPGSPSRPQIRQKIENKPLQEQLSVNQIKTEPVDYEFKPIV
VASGINCSTPLQNGVFTGGGPLQATSSPQGVVQAVVLPTVGLVSPISINLSDIQNVLKVA
VDGNVIRQVLENNQASLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSL
EQPSQLQVVPQNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPG
DINALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAY
YALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPSKNN
DQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGY
LYTAEGAQEEPQVEPLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNLSCAKKEPQK
DSCVTDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIP
QVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKT
ENGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKP
YQCDKCGKRFSHSGSYSQHMNHRYSYCKREAEERDSTEQEEAGPEILSNEHVGARASPSQ
GDSDERESLTREDDEDSEKEEEEEDKEMEELQEEKECEKPQGDEEEEEEEEEEAEEEEVE
DAENEGEAAKPEGLMKDDRAESQASSLGQKVSESSEQVSEEKTNEA
NT seq 3381 nt   +upstreamnt  +downstreamnt
atggcggatggccccaggtgtaagcgcagaaagcaggcgaacccgcggcgcaataacgtt
acaaattataatactgtggtagaaacaaattcagattcagatgatgaagacaaactccat
attgtggaagaagaaagtgttacagatgcagctgattgtgaaggtgtaccagaggatgac
ctgccaacagaccagacagtgttaccagggaggagcagtgaaagagaagggaatgctaag
aactgctgggaggatgacacaggaaaggaagggcaagaaatcctggggcctgaagctcag
gcagatgaagcaggatgtacagtaaaagatgatgaatgcgagtcagatgcagaaaatgag
caaaaccatgatcctaatgttgaagagtttctgcaacaacaagacactgctgtcattttt
cctgaggcacctgaagaggaccagaggcagggtacaccagaagccagtggtcatgatgaa
aatggaacaccagatgcattttcacagttactcacctgtccatattgtgatagaggctat
aaacgctttacctctctgaaagaacacattaaatatcgtcatgaaaagaacgaagataac
tttagttgctccctgtgcagttacacctttgcatacagaacccaacttgaacgtcacatg
acatcacataaatcaggaagagatcaaagacatgtgacgcagtctgggtgtaatcgtaaa
ttcaagtgcactgagtgtggaaaagctttcaaatacaaacaccacctaaaagagcactta
agaattcacagtggagagaagccatatgaatgcccaaactgcaagaaacgcttttcccat
tctggctcctatagctcacacataagcagtaagaaatgtatcagcttgatacctgtgaat
gggcgaccaagaacaggactcaagacatctcagtgctcttcaccgtctctttcagcatca
ccaggcagtccctcacgaccacagatacggcaaaagatagagaataaaccccttcaggaa
cagctttctgttaaccaaattaaaactgaacctgtggattatgaattcaaacccatagtg
gttgcttcaggaatcaactgttcaacccctttacaaaatggggttttcactggtggtggc
ccattacaggcaaccagttctcctcagggcgtggtgcaagctgttgttctgccaacagtt
ggtttggtgtctcccataagtatcaatttaagtgatattcagaatgtacttaaagtggca
gtagatggtaatgtaatacgacaagtgttggagaataatcaagccagtcttgcatccaaa
gaacaagaaacaatcaatgcttcacccatacaacaaggtggccattctgttatttcagcc
atcagtcttcctttggttgatcaagatggaacaaccaaaattatcatcaactatagtctt
gagcagcctagccaacttcaagttgttcctcaaaatttaaaaaaagaaaatccagttgct
acaaacagttgtaaaagtgaaaagttaccagaagatcttactgttaagtctgagaaggac
aaaagctttgaagggggggtgaatgatagcacttgtcttctgtgtgatgattgtccagga
gatattaatgcacttccagaattaaagcactatgacctaaagcagcctactcagcctcct
ccactccctgcagcagaagctgagaaacctgagtcctctgtttcatcagctactggagat
ggcaatttatctcccagtcagccacctttaaagaacctcttgtctctcctaaaagcatat
tatgctttgaatgcacaaccaagtgcagaagagctctcaaaaattgctgattcagtaaac
ctaccactggatgtagtaaaaaagtggtttgaaaagatgcaagctggacagatttcagtg
cagtcttctgaaccatcttctcctgaaccaggcaaagtaaatatcccttccaagaacaat
gatcagcctcaatctgcaaatgcaaatgaaccccaggacagcacagtaaacctacaaagt
cctttgaagatgactaactccccagttttaccagtgggatcaaccaccaatggttccaga
agtagtacaccatccccatcacctctaaacctttcctcatccagaaatacacagggttac
ttgtacacagctgagggtgcacaagaagagccacaagtagaacctcttgatctttcacta
ccaaagcaacagggagaattattagaaaggtcaactatcactagtgtttaccagaacagt
gtttattctgtccaggaagaacccttgaacttgtcttgcgcaaaaaaggagccacaaaag
gacagttgtgttacagactcagaaccagttgtaaatgtaatcccaccaagtgccaacccc
ataaatatcgctatacctacagtcactgcccagttacccacaatcgtggccattgctgac
cagaacagtgttccatgcttacgagcactagctgccaataagcaaacgattctgattccc
caggtggcatacacatactcaactacagtcagccctgcagtccaagaaccacccttgaaa
gtgatccagccaaatggaaatcaggatgaaagacaagatactagctcagaaggagtatca
aatgtagaggatcagaatgactctgattctacaccacccaaaaagaaaatgcggaagaca
gaaaatggaatgtatgcttgtgacttgtgtgataagatattccaaaagagtagttcatta
ttgagacataaatatgaacacacaggtaaaagacctcatgagtgtggaatctgtaaaaag
gcatttaaacacaaacatcatttgattgaacacatgcgattacattctggagaaaagccc
tatcaatgtgacaaatgtggaaagcgcttctcacactctgggtcttattctcaacacatg
aatcatcgctactcctactgtaagagagaagcggaagaacgtgacagcacagagcaggaa
gaggcagggcctgaaatcctctcgaatgagcatgtgggtgccagggcatctccctcacag
ggcgactcggacgagagagagagtttgacaagggaagacgatgaagacagtgaaaaagag
gaagaggaggaggataaagagatggaagaattgcaggaagaaaaagaatgtgaaaaacca
caaggggatgaggaagaggaggaggaggaggaggaagaagcggaagaagaagaggtagaa
gatgcagagaatgagggagaagcagcaaaacctgaaggtctgatgaaggatgacagggct
gaaagtcaagcaagcagcttaggacaaaaagtaagcgagagtagtgagcaagtgtctgaa
gaaaagacaaatgaagcctga

DBGET integrated database retrieval system