KEGG   Macaca mulatta (rhesus monkey): 701195
Entry
701195            CDS       T01028                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta type
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04062  Chemokine signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04070  Phosphatidylinositol signaling system
mcc04071  Sphingolipid signaling pathway
mcc04150  mTOR signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04310  Wnt signaling pathway
mcc04370  VEGF signaling pathway
mcc04510  Focal adhesion
mcc04540  Gap junction
mcc04613  Neutrophil extracellular trap formation
mcc04650  Natural killer cell mediated cytotoxicity
mcc04662  B cell receptor signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04670  Leukocyte transendothelial migration
mcc04713  Circadian entrainment
mcc04720  Long-term potentiation
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04727  GABAergic synapse
mcc04728  Dopaminergic synapse
mcc04730  Long-term depression
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04919  Thyroid hormone signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04929  GnRH secretion
mcc04931  Insulin resistance
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc04960  Aldosterone-regulated sodium reabsorption
mcc04961  Endocrine and other factor-regulated calcium reabsorption
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc04973  Carbohydrate digestion and absorption
mcc05017  Spinocerebellar ataxia
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05031  Amphetamine addiction
mcc05032  Morphine addiction
mcc05140  Leishmaniasis
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05214  Glioma
mcc05223  Non-small cell lung cancer
mcc05225  Hepatocellular carcinoma
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    701195 (PRKCB)
   04012 ErbB signaling pathway
    701195 (PRKCB)
   04014 Ras signaling pathway
    701195 (PRKCB)
   04015 Rap1 signaling pathway
    701195 (PRKCB)
   04310 Wnt signaling pathway
    701195 (PRKCB)
   04370 VEGF signaling pathway
    701195 (PRKCB)
   04064 NF-kappa B signaling pathway
    701195 (PRKCB)
   04066 HIF-1 signaling pathway
    701195 (PRKCB)
   04020 Calcium signaling pathway
    701195 (PRKCB)
   04070 Phosphatidylinositol signaling system
    701195 (PRKCB)
   04071 Sphingolipid signaling pathway
    701195 (PRKCB)
   04150 mTOR signaling pathway
    701195 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    701195 (PRKCB)
   04540 Gap junction
    701195 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    701195 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    701195 (PRKCB)
   04662 B cell receptor signaling pathway
    701195 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    701195 (PRKCB)
   04670 Leukocyte transendothelial migration
    701195 (PRKCB)
   04062 Chemokine signaling pathway
    701195 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    701195 (PRKCB)
   04929 GnRH secretion
    701195 (PRKCB)
   04912 GnRH signaling pathway
    701195 (PRKCB)
   04921 Oxytocin signaling pathway
    701195 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    701195 (PRKCB)
   04918 Thyroid hormone synthesis
    701195 (PRKCB)
   04919 Thyroid hormone signaling pathway
    701195 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    701195 (PRKCB)
   04916 Melanogenesis
    701195 (PRKCB)
   04925 Aldosterone synthesis and secretion
    701195 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    701195 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    701195 (PRKCB)
   04971 Gastric acid secretion
    701195 (PRKCB)
   04972 Pancreatic secretion
    701195 (PRKCB)
   04973 Carbohydrate digestion and absorption
    701195 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    701195 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    701195 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    701195 (PRKCB)
   04727 GABAergic synapse
    701195 (PRKCB)
   04725 Cholinergic synapse
    701195 (PRKCB)
   04728 Dopaminergic synapse
    701195 (PRKCB)
   04726 Serotonergic synapse
    701195 (PRKCB)
   04720 Long-term potentiation
    701195 (PRKCB)
   04730 Long-term depression
    701195 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    701195 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    701195 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    701195 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    701195 (PRKCB)
   05206 MicroRNAs in cancer
    701195 (PRKCB)
   05205 Proteoglycans in cancer
    701195 (PRKCB)
   05231 Choline metabolism in cancer
    701195 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    701195 (PRKCB)
   05214 Glioma
    701195 (PRKCB)
   05223 Non-small cell lung cancer
    701195 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    701195 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    701195 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    701195 (PRKCB)
   05032 Morphine addiction
    701195 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    701195 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    701195 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    701195 (PRKCB)
   05161 Hepatitis B
    701195 (PRKCB)
   05171 Coronavirus disease - COVID-19
    701195 (PRKCB)
   05164 Influenza A
    701195 (PRKCB)
   05163 Human cytomegalovirus infection
    701195 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    701195 (PRKCB)
   05140 Leishmaniasis
    701195 (PRKCB)
   05143 African trypanosomiasis
    701195 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    701195 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    701195 (PRKCB)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     701195 (PRKCB)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   701195 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 701195
NCBI-ProteinID: NP_001244443
Ensembl: ENSMMUG00000014271
UniProt: H9FX30
LinkDB
Position
20
AA seq 673 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE
LRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagcgagggcgaggagagcaccgtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcacgaggtcaagaaccacaaatttacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcagggattccagtgccaagtttgctgctttgtggtgcacaagcggtgccatgaa
tttgtcacattctcctgccctggcgctgacaagggtccagcctctgatgatccccggagc
aaacacaagtttaagatccacacgtactccagtcccacgttttgtgaccactgtgggtca
ctgctgtatggactcatccaccaggggatgaaatgtgacacctgcatgatgaacgtgcac
aagcgctgcgtgatgaacgtccccagcctctgtggcacggaccacacggagcgccgcggc
cgcatctacatccaggcccacattgacagggatgttctcatcgtcctcgtaagagatgct
aaaaaccttgtacctatggaccccaatggcctgtcagatccctacgtaaaactgaaactg
attcctgatcccaaaagtgagagcaaacagaagaccaaaaccatcaaatgctccctcaac
cctgagtggaacgagacatttagatttcagctgaaagaatcggacaaagacagaagactg
tcagtagagatttgggattgggatttgaccagcaggaatgacttcatgggatctttgtcc
tttgggatttctgaacttcagaaagccagtgttgatggctggtttaagttactgagccag
gaggaaggcgagtacttcaatgtgcctgtgccaccagaaggaagtgagggcaacgaagaa
ctgcggcagaaatttgagagggccaagatcagtcagggaaccaaagtcccggaagaaaag
acgaccaatactgtctccaaatttgacaacaatggcaacagagaccggatgaaactgact
gattttaacttcctaatggtgctggggaaaggcagctttggcaaggtcatgctttcagaa
cgaaaaggcacagatgagctctatgctgtgaagatcctgaagaaggatgtcgtgatccaa
gatgatgatgtggagtgcactatggtggagaagcgggtgctggccctacccgggaagccg
cccttcctgacccagctccactcctgcttccagaccatggaccgcctgtactttgtgatg
gagtacgtcaacgggggcgacctcatgtatcacatccagcaagttggccggttcaaggag
ccccatgccgtattttacgctgcagaaattgccatcggtctgttcttcttacagagtaag
ggcatcatttaccgtgacctaaaacttgacaacgtgatgctcgattctgaggggcacatc
aagattgctgattttggcatgtgtaaggagaacatctgggatggggtgacaaccaagaca
ttctgtggcactccagactacatcgcccctgagataattgcttatcagccctatgggaag
tccgtggattggtgggcatttggagtcctgctgtatgaaatgttggctgggcaggcaccc
tttgaaggggaggatgaagatgaactcttccagtccatcatggaacacaacgtagcctat
cccaagtctatgtctaaggaagctgtggccatctgcaaagggctgatgaccaaacacccg
ggcaaacgtttgggttgtggacctgaaggcgaacgtgatatcaaagagcatgcatttttc
cggtatattgattgggagaaacttgaacgcaaagagatccagcccccatataagccaaaa
gcttgtgggcgaaatgctgaaaacttcgaccgatttttcacccgccatccaccagtccta
acacctcccgaccaggaagtcatcaggaatattgaccaatcagaattcgaaggattttcc
tttgttaactctgaatttttaaaacccgaagtcaagagctaa

KEGG   Macaca mulatta (rhesus monkey): 718412
Entry
718412            CDS       T01028                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04070  Phosphatidylinositol signaling system
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04310  Wnt signaling pathway
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04510  Focal adhesion
mcc04540  Gap junction
mcc04613  Neutrophil extracellular trap formation
mcc04650  Natural killer cell mediated cytotoxicity
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04670  Leukocyte transendothelial migration
mcc04713  Circadian entrainment
mcc04720  Long-term potentiation
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04727  GABAergic synapse
mcc04728  Dopaminergic synapse
mcc04730  Long-term depression
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04919  Thyroid hormone signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04929  GnRH secretion
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc04960  Aldosterone-regulated sodium reabsorption
mcc04961  Endocrine and other factor-regulated calcium reabsorption
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc05017  Spinocerebellar ataxia
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05031  Amphetamine addiction
mcc05032  Morphine addiction
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05214  Glioma
mcc05223  Non-small cell lung cancer
mcc05225  Hepatocellular carcinoma
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    718412 (PRKCA)
   04012 ErbB signaling pathway
    718412 (PRKCA)
   04014 Ras signaling pathway
    718412 (PRKCA)
   04015 Rap1 signaling pathway
    718412 (PRKCA)
   04310 Wnt signaling pathway
    718412 (PRKCA)
   04370 VEGF signaling pathway
    718412 (PRKCA)
   04066 HIF-1 signaling pathway
    718412 (PRKCA)
   04020 Calcium signaling pathway
    718412 (PRKCA)
   04070 Phosphatidylinositol signaling system
    718412 (PRKCA)
   04072 Phospholipase D signaling pathway
    718412 (PRKCA)
   04071 Sphingolipid signaling pathway
    718412 (PRKCA)
   04151 PI3K-Akt signaling pathway
    718412 (PRKCA)
   04150 mTOR signaling pathway
    718412 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    718412 (PRKCA)
   04540 Gap junction
    718412 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    718412 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    718412 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    718412 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    718412 (PRKCA)
   04670 Leukocyte transendothelial migration
    718412 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    718412 (PRKCA)
   04929 GnRH secretion
    718412 (PRKCA)
   04912 GnRH signaling pathway
    718412 (PRKCA)
   04921 Oxytocin signaling pathway
    718412 (PRKCA)
   04926 Relaxin signaling pathway
    718412 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    718412 (PRKCA)
   04918 Thyroid hormone synthesis
    718412 (PRKCA)
   04919 Thyroid hormone signaling pathway
    718412 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    718412 (PRKCA)
   04916 Melanogenesis
    718412 (PRKCA)
   04925 Aldosterone synthesis and secretion
    718412 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    718412 (PRKCA)
   04270 Vascular smooth muscle contraction
    718412 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    718412 (PRKCA)
   04971 Gastric acid secretion
    718412 (PRKCA)
   04972 Pancreatic secretion
    718412 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    718412 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    718412 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    718412 (PRKCA)
   04727 GABAergic synapse
    718412 (PRKCA)
   04725 Cholinergic synapse
    718412 (PRKCA)
   04728 Dopaminergic synapse
    718412 (PRKCA)
   04726 Serotonergic synapse
    718412 (PRKCA)
   04720 Long-term potentiation
    718412 (PRKCA)
   04730 Long-term depression
    718412 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    718412 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    718412 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    718412 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    718412 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    718412 (PRKCA)
   05206 MicroRNAs in cancer
    718412 (PRKCA)
   05205 Proteoglycans in cancer
    718412 (PRKCA)
   05231 Choline metabolism in cancer
    718412 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    718412 (PRKCA)
   05214 Glioma
    718412 (PRKCA)
   05223 Non-small cell lung cancer
    718412 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    718412 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    718412 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    718412 (PRKCA)
   05032 Morphine addiction
    718412 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    718412 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    718412 (PRKCA)
   05161 Hepatitis B
    718412 (PRKCA)
   05171 Coronavirus disease - COVID-19
    718412 (PRKCA)
   05164 Influenza A
    718412 (PRKCA)
   05163 Human cytomegalovirus infection
    718412 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    718412 (PRKCA)
   05143 African trypanosomiasis
    718412 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    718412 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    718412 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    718412 (PRKCA)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     718412 (PRKCA)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   718412 (PRKCA)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    718412 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 718412
NCBI-ProteinID: NP_001247662
Ensembl: ENSMMUG00000018378
UniProt: H9EMT3
LinkDB
Position
16
AA seq 672 aa
MADVFPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccggccaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcgcgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacagggcttccagtgccaagtttgctgttttgtggtccacaagaggtgccatgaa
tttgttactttttcttgtccgggtgcagataagggacccgacactgatgaccccaggagc
aagcacaagttcaaaatccacacttacggaagccccaccttctgcgatcactgtgggtcc
ctgctgtatggacttatccaccaagggatgaaatgtgacacctgcgatatgaacgttcac
aagcaatgcgtcatcaatgtccccagcctctgcggaatggatcacacagagaagaggggg
cggatttacctaaaggctgaggttgctgatgaaaagctccatgtcacagtacgagatgca
aaaaatctaatccctatggatccaaacgggctttcagatccttatgtgaagctgaaactt
attcctgatcccaagaatgaaagcaaacaaaaaaccaaaaccatccgctccacactaaat
ccccagtggaatgagtcctttacattcaaactgaaaccttcagacaaagaccgacgactg
tctgtagaaatctgggactgggatcgaacaacaaggaatgacttcatgggatccctttcc
tttggggtttcggaactaatgaagatgccagccagtggatggtacaagttgcttaaccaa
gaagaaggtgagtactacaatgtacccattccagaaggggacgaagaaggaaacatggaa
ctcaggcagaaattcgagaaagccaagcttggccctgctggcaacaaagtcatcagtccc
tctgaagacaggaaacagccttccaacaacctggaccgagtgaaactcaccgacttcaat
ttcctcatggtgctggggaaggggagttttggaaaggtgatgcttgccgacaggaagggc
acagaagaactgtatgcaatcaaaatcctgaagaaggatgtggtgattcaggacgacgac
gtggagtgcaccatggtagaaaaacgagtcttggccctgcttgacaaacccccgttcttg
acgcagctgcactcctgcttccagacagtggatcggctgtacttcgtcatggaatatgtc
aacggtggggacctcatgtaccacattcagcaagtaggaaaatttaaggaaccacaagca
gtattctatgcggcagagatttccatcggattgttctttcttcataaaagaggaatcatt
tatagggatctgaagttagataacgtcatgttggattcagaaggacatatcaaaattgct
gactttgggatgtgcaaggaacatatgatggatggagtcacgaccaggaccttctgtggg
actccagattacatcgccccagagattatcgcttatcagccatatggaaaatctgtggac
tggtgggcctatggcgtcctgttgtatgaaatgcttgccgggcagcctccatttgatggt
gaagatgaagacgagctgtttcagtctatcatggagcacaacgtttcctatccaaaatcc
ttgtccaaggaggctgtttccatctgcaaaggactaatgaccaaacacccagccaagcgg
ctgggctgcgggcctgagggggagagggacgtgagagaacatgctttcttccggaggatc
gactgggaaaaactggagaacagggagatccagccaccgttcaagcccaaagtgtgcggc
aaaggagcagaaaactttgacaagttcttcacacgagggcagcccgtcttaacgccgcct
gatcagctggttatcgctaacatagaccagtctgattttgaagggttctcgtatgtcaac
ccccagtttgtgcaccccatcttacagagtgcggtatga

KEGG   Macaca mulatta (rhesus monkey): 720263
Entry
720263            CDS       T01028                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma type
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04070  Phosphatidylinositol signaling system
mcc04071  Sphingolipid signaling pathway
mcc04150  mTOR signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04310  Wnt signaling pathway
mcc04370  VEGF signaling pathway
mcc04510  Focal adhesion
mcc04540  Gap junction
mcc04613  Neutrophil extracellular trap formation
mcc04650  Natural killer cell mediated cytotoxicity
mcc04666  Fc gamma R-mediated phagocytosis
mcc04670  Leukocyte transendothelial migration
mcc04713  Circadian entrainment
mcc04720  Long-term potentiation
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04727  GABAergic synapse
mcc04728  Dopaminergic synapse
mcc04730  Long-term depression
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04919  Thyroid hormone signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04929  GnRH secretion
mcc04935  Growth hormone synthesis, secretion and action
mcc04960  Aldosterone-regulated sodium reabsorption
mcc04961  Endocrine and other factor-regulated calcium reabsorption
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc05017  Spinocerebellar ataxia
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05031  Amphetamine addiction
mcc05032  Morphine addiction
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05214  Glioma
mcc05223  Non-small cell lung cancer
mcc05225  Hepatocellular carcinoma
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    720263 (PRKCG)
   04012 ErbB signaling pathway
    720263 (PRKCG)
   04014 Ras signaling pathway
    720263 (PRKCG)
   04015 Rap1 signaling pathway
    720263 (PRKCG)
   04310 Wnt signaling pathway
    720263 (PRKCG)
   04370 VEGF signaling pathway
    720263 (PRKCG)
   04066 HIF-1 signaling pathway
    720263 (PRKCG)
   04020 Calcium signaling pathway
    720263 (PRKCG)
   04070 Phosphatidylinositol signaling system
    720263 (PRKCG)
   04071 Sphingolipid signaling pathway
    720263 (PRKCG)
   04150 mTOR signaling pathway
    720263 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    720263 (PRKCG)
   04540 Gap junction
    720263 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    720263 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    720263 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    720263 (PRKCG)
   04670 Leukocyte transendothelial migration
    720263 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    720263 (PRKCG)
   04929 GnRH secretion
    720263 (PRKCG)
   04921 Oxytocin signaling pathway
    720263 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    720263 (PRKCG)
   04918 Thyroid hormone synthesis
    720263 (PRKCG)
   04919 Thyroid hormone signaling pathway
    720263 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    720263 (PRKCG)
   04916 Melanogenesis
    720263 (PRKCG)
   04925 Aldosterone synthesis and secretion
    720263 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    720263 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    720263 (PRKCG)
   04971 Gastric acid secretion
    720263 (PRKCG)
   04972 Pancreatic secretion
    720263 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    720263 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    720263 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    720263 (PRKCG)
   04727 GABAergic synapse
    720263 (PRKCG)
   04725 Cholinergic synapse
    720263 (PRKCG)
   04728 Dopaminergic synapse
    720263 (PRKCG)
   04726 Serotonergic synapse
    720263 (PRKCG)
   04720 Long-term potentiation
    720263 (PRKCG)
   04730 Long-term depression
    720263 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    720263 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    720263 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    720263 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    720263 (PRKCG)
   05206 MicroRNAs in cancer
    720263 (PRKCG)
   05205 Proteoglycans in cancer
    720263 (PRKCG)
   05231 Choline metabolism in cancer
    720263 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    720263 (PRKCG)
   05214 Glioma
    720263 (PRKCG)
   05223 Non-small cell lung cancer
    720263 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    720263 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    720263 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    720263 (PRKCG)
   05032 Morphine addiction
    720263 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    720263 (PRKCG)
   05161 Hepatitis B
    720263 (PRKCG)
   05171 Coronavirus disease - COVID-19
    720263 (PRKCG)
   05163 Human cytomegalovirus infection
    720263 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    720263 (PRKCG)
   05143 African trypanosomiasis
    720263 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    720263 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    720263 (PRKCG)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     720263 (PRKCG)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   720263 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like APH
Other DBs
NCBI-GeneID: 720263
NCBI-ProteinID: XP_014980325
Ensembl: ENSMMUG00000007972
UniProt: F7H3B3
LinkDB
Position
19
AA seq 697 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHITVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggctggtctgggccccggcggaggcgattcagaggggggaccccggcccctgttttgc
agaaagggggctctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgct
cgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggtatcgga
aagcaaggcctgcaatgtcaagtctgcagctttgtggtccatcgacgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggacgacccccggaacaag
cacaagttccgcctgcatagctacagcagccctaccttctgcgaccactgtggctccctc
ctgtacgggcttgtgcaccagggcatgaaatgctcctgctgcgagatgaacgtgcaccgg
cgctgtgtgcgtagcgtgccctccctgtgcggtgtggaccacaccgagcgccgcgggcgc
ctgcagctggagatccgggctcccactgcagatgagatccacataacggttggcgaggcc
cgtaaccttattcctatggaccccaatggtctctctgatccctatgtgaaactgaagctc
atcccagaccctcggaacctgacgaaacagaaaacccgaacggtgaaagccacgctaaat
cctgtgtggaatgagacctttgtgttcaacctgaagcctggggatgtggagcgccggctc
agcgtggaggtgtgggactgggaccggacctcccgcaacgacttcatgggtgccatgtcc
tttggcgtctcagagctgctcaaggcgccagtggatggctggtacaagttactgaaccag
gaggagggcgagtattacaatgtgccggtggccgatgctgacaactgcagcctcctccag
aagtttgaggcttgtaactaccccctggaattgtatgagcgggtgcggatgggcccctct
tcctctcccatcccctccccttcccctagtcccaccgaccccaagcgctgcttcttcggg
gcaagcccaggacgtctgcacatctccgacttcagcttcctcatggttctaggaaaaggc
agttttgggaaggtgatgctggccgagcgcagaggctctgatgagctctacgccatcaaa
atcctgaaaaaggacgtgatcgtccaggatgacgacgtggactgcacgctggtggagaaa
cgcgtgctggcgctggggggccggggtcctggcggtcggccccacttcctcacccaactc
cactccaccttccagaccccggaccgcctgtatttcgtgatggagtacgtcaccggggga
gacttgatgtaccacattcaacagctgggcaagtttaaggagccccatgcagcgttctac
gcagcagaaatcgccatcggcctcttcttccttcacaatcagggcatcatctacagggac
ctgaagctggacaatgtgatgctggatgctgagggacacatcaagatcactgacttcggc
atgtgtaaggagaacgtcttccccgggacgacaacccgcaccttctgcgggaccccggac
tacatagccccggagatcattgcctaccagccctatgggaagtctgtcgattggtggtcc
tttggagttctgctgtatgagatgttggcaggacagcctcccttcgatggggaggacgaa
gaggagctgtttcaggccatcatggaacaaactgtcacctaccccaagtcgctttcccgg
gaagccgtggccatctgcaaggggttcctgaccaagcacccagggaagcgcctgggctca
gggcctgatggggaacctaccatccgtgcacatggctttttccgctggattgactgggaa
cggctggaacgattggagatcccgcctcctttcagaccccgcccgtgtggccgcagcggc
gagaactttgacaagttcttcacgcgggcggcgccagcgctgacccctccagaccgccta
gtcctggccagcatcgaccaggccgatttccagggctttacctacgtgaaccccgacttc
gtgcatccggatgcccgcagccccaccagcccagtgcctgtgcccgtcatgtaa

DBGET integrated database retrieval system