KEGG   Macaca mulatta (rhesus monkey): 701237
Entry
701237            CDS       T01028                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01523  Antifolate resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04062  Chemokine signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04380  Osteoclast differentiation
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04668  TNF signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc05132  Salmonella infection
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05212  Pancreatic cancer
mcc05215  Prostate cancer
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
mcc05222  Small cell lung cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05340  Primary immunodeficiency
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    701237 (IKBKG)
   04014 Ras signaling pathway
    701237 (IKBKG)
   04064 NF-kappa B signaling pathway
    701237 (IKBKG)
   04668 TNF signaling pathway
    701237 (IKBKG)
   04151 PI3K-Akt signaling pathway
    701237 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    701237 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    701237 (IKBKG)
   04621 NOD-like receptor signaling pathway
    701237 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    701237 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    701237 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    701237 (IKBKG)
   04660 T cell receptor signaling pathway
    701237 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    701237 (IKBKG)
   04659 Th17 cell differentiation
    701237 (IKBKG)
   04657 IL-17 signaling pathway
    701237 (IKBKG)
   04662 B cell receptor signaling pathway
    701237 (IKBKG)
   04062 Chemokine signaling pathway
    701237 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    701237 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    701237 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    701237 (IKBKG)
   05203 Viral carcinogenesis
    701237 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    701237 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    701237 (IKBKG)
   05221 Acute myeloid leukemia
    701237 (IKBKG)
   05220 Chronic myeloid leukemia
    701237 (IKBKG)
   05215 Prostate cancer
    701237 (IKBKG)
   05222 Small cell lung cancer
    701237 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    701237 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    701237 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    701237 (IKBKG)
   05135 Yersinia infection
    701237 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    701237 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    701237 (IKBKG)
   05161 Hepatitis B
    701237 (IKBKG)
   05160 Hepatitis C
    701237 (IKBKG)
   05171 Coronavirus disease - COVID-19
    701237 (IKBKG)
   05164 Influenza A
    701237 (IKBKG)
   05162 Measles
    701237 (IKBKG)
   05168 Herpes simplex virus 1 infection
    701237 (IKBKG)
   05163 Human cytomegalovirus infection
    701237 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    701237 (IKBKG)
   05169 Epstein-Barr virus infection
    701237 (IKBKG)
   05165 Human papillomavirus infection
    701237 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    701237 (IKBKG)
   05142 Chagas disease
    701237 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    701237 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    701237 (IKBKG)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   701237 (IKBKG)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 Bacillus_HBL LLC1
Other DBs
NCBI-GeneID: 701237
NCBI-ProteinID: XP_001095498
Ensembl: ENSMMUG00000017277
UniProt: F7GMH1
LinkDB
Position
X
AA seq 419 aa
MSRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGTPETLQRCLEENQE
LRDAIRQSNQMLRERCEELLHFQASQREEKEFLMCKFQEARKLVERLSLEKLDLKRQKEQ
ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQTLEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSLVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH
VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcaggcacctctggaagagccaactgtgtgagatggtgcagcccagtggtggcccg
gcagcagatcaggacgtgctgggtgaagagtctcctctggggaagccagccatgctgcac
ctgccttcagagcagggcactcctgagactctccagcgctgcctggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagatgctgcgagagcgctgcgaggagcttctg
catttccaagccagccagagggaggagaaggagttcctcatgtgcaaattccaagaggcc
aggaaactggtggagagactcagcctggagaagctcgacctgaagaggcagaaagagcag
gctctgcgggaggtagagcacctgaagagatgccagcagcagatggctgaggacaaggcc
tctgtgaaagcccaggtgacatccttgctcggggagctgcaggagagccagagtcgcctg
gaggctgccactaaggaatgccagactctggagggtcgggcccgggcggccagcgagcag
gcgcggcagctggagagtgagcgtgaggcactgcagcagcagcacagcgtgcaggtggac
cagctgcgcatgcagggccagagcgtggaggccgcactccgcatggagcgccaggctgcc
tcggaggagaagcggaagctggcccagttgcaggtggcctatcaccagctcttccaagaa
tacgacaaccacatcaagagcagcctggtgggcagcgagcggaagcgaggaatgcagctg
gaagatctcaagcagcagctccagcaggccgaggaggccctggtggccaaacaggaggtg
attgataagctgaaggaggaggccgagcagcacaagattgtgatggagaccgttccggtg
ctgaaggcccaggcggacatctacaaggcggacttccaggctgagaggcaggctcgggag
aagctggccgagaagaaggagctcttgcaggagcagctggagcagctgcagagggagtac
agcaaactgaaggccagctgtcaggagtcggccaggatcgaggacatgaggaagcggcat
gttgaggtctcccaggcccccttgccccccgcccccgcctacctctcctctcccctggcc
ctgcctagccagaggaggagcccccctgaggagccacctgacttctgctgtcccaagtgc
cagtatcaggcccctgatatggacaccctgcagatacatgtcatggagtgcattgagtag

KEGG   Macaca mulatta (rhesus monkey): 704683
Entry
704683            CDS       T01028                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01523  Antifolate resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04062  Chemokine signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04068  FoxO signaling pathway
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04380  Osteoclast differentiation
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04668  TNF signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc04910  Insulin signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04930  Type II diabetes mellitus
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc05010  Alzheimer disease
mcc05132  Salmonella infection
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05212  Pancreatic cancer
mcc05215  Prostate cancer
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
mcc05222  Small cell lung cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    704683 (IKBKB)
   04014 Ras signaling pathway
    704683 (IKBKB)
   04064 NF-kappa B signaling pathway
    704683 (IKBKB)
   04668 TNF signaling pathway
    704683 (IKBKB)
   04068 FoxO signaling pathway
    704683 (IKBKB)
   04151 PI3K-Akt signaling pathway
    704683 (IKBKB)
   04150 mTOR signaling pathway
    704683 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    704683 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    704683 (IKBKB)
   04621 NOD-like receptor signaling pathway
    704683 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    704683 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    704683 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    704683 (IKBKB)
   04660 T cell receptor signaling pathway
    704683 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    704683 (IKBKB)
   04659 Th17 cell differentiation
    704683 (IKBKB)
   04657 IL-17 signaling pathway
    704683 (IKBKB)
   04662 B cell receptor signaling pathway
    704683 (IKBKB)
   04062 Chemokine signaling pathway
    704683 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    704683 (IKBKB)
   04920 Adipocytokine signaling pathway
    704683 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    704683 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    704683 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    704683 (IKBKB)
   05206 MicroRNAs in cancer
    704683 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    704683 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    704683 (IKBKB)
   05221 Acute myeloid leukemia
    704683 (IKBKB)
   05220 Chronic myeloid leukemia
    704683 (IKBKB)
   05215 Prostate cancer
    704683 (IKBKB)
   05222 Small cell lung cancer
    704683 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    704683 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    704683 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    704683 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    704683 (IKBKB)
   04931 Insulin resistance
    704683 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    704683 (IKBKB)
   05135 Yersinia infection
    704683 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    704683 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    704683 (IKBKB)
   05161 Hepatitis B
    704683 (IKBKB)
   05160 Hepatitis C
    704683 (IKBKB)
   05171 Coronavirus disease - COVID-19
    704683 (IKBKB)
   05164 Influenza A
    704683 (IKBKB)
   05162 Measles
    704683 (IKBKB)
   05168 Herpes simplex virus 1 infection
    704683 (IKBKB)
   05163 Human cytomegalovirus infection
    704683 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    704683 (IKBKB)
   05169 Epstein-Barr virus infection
    704683 (IKBKB)
   05165 Human papillomavirus infection
    704683 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    704683 (IKBKB)
   05142 Chagas disease
    704683 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    704683 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    704683 (IKBKB)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     704683 (IKBKB)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   704683 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo ubiquitin APH YrbL-PhoP_reg Med20 Glyco_hydro_65m
Other DBs
NCBI-GeneID: 704683
NCBI-ProteinID: NP_001252875
Ensembl: ENSMMUG00000008351
UniProt: F6SHC1 G7MZ74
LinkDB
Position
8
AA seq 756 aa
MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
VDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPKYGPNGCF
KALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLA
LIPDKPATQCISDGKLNEGRTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRN
LAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQS
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLSQPGQLMSQPSTASNSLPEPAKKSEELVAEAHNLCTLLE
NAIQDTVREQDQSFTALDWSWLQTEEEEHSCLEQAS
NT seq 2271 nt   +upstreamnt  +downstreamnt
atgagctggtcaccttccctgacaacccagacatgtggggcctgggaaatgaaagagcgc
cttgggacagggggatttggaaatgtcatccgatggcacaatcaggaaacaggtgagcag
attgccatcaagcagtgccggcaggagctcagcccccggaatcgagagcggtggtgcctg
gagatccagatcatgagaaggctgacgcaccccaatgtggtggctgcccgagatgtccct
gaggggatgcagaacttggcgcccaatgacttgcccctgctggccatggagtattgccaa
ggaggagatctccggaagtacctgaaccagtttgagaattgctgtggtctgcgggaaggt
gccatcctcaccttgctgagtgacattgcctctgcacttagataccttcatgaaaacaga
atcatccatcgggatctaaagccagaaaacatcgtcctgcagcaaggagaacagaggtta
atacacaaaattattgacctaggatatgccaaggagctggatcagggcagtctttgcacg
tcattcgtggggaccctgcagtacctggccccagagctgctggagcagcagaagtacaca
gtgaccgtcgactactggagctttggcaccctggccttcgagtgcatcacgggcttccgg
cccttcctccccaactggcagcccgtgcagtggcattcgaaagtccggcagaagagtgag
gtggatattgttgtcagcgaagacttgaatggaacagtgaagttttcaagctctttaccc
taccccaataatcttaacagcgtcctggctgagcgactggagaagtggctgcaactgatg
ctgatgtggcatccccgacagaggggcacagatcccaagtatgggcccaatggctgcttc
aaggccctggatgacatcttaaacttaaagctggttcatatcttgaacatggtcacaggc
accatccacacctaccctgtgacagaggacgagagtctgcagagcttgaaggccagaatc
cagcaggacacgggcatcccagaggaggaccaggagctgctgcaggaagcgggcctggcg
ttgatccccgataaacctgccactcagtgtatttcagatggcaagttaaatgagggccgc
acattggacatggatcttgtttttctctttgacaacagtaaaatcacctatgagactcag
atctccccacggccccaacctgaaagtgtcagctgtatccttcaagagcccaagaggaac
ctcgccttcttccagctgaggaaggtgtggggccaggtctggcacagcatccagacccta
aaggaggattgcaaccggctgcagcagggacagcgagccgccatgatgaatctcctccgg
aacaacagctgcctctccaagatgaagaattccatggcttccatgtctcagcagctcaag
gccaagttggatttcttcaaaaccagcatccagattgacctggagaagtacagcgagcaa
actgagtttgggatcacatcagataaactgctgctggcctggagggaaatggagcaggcc
gtggagctctgtgggcgggagaacgaagtgaaactcctggtagaacggatgatggctctg
cagacggacatcgtggacttacagaggagccccatgggccggaagcaggggggaacattg
gacgacctagaggagcaagcaagggagctgtacaggagactaagggaaaagcctcgagac
cagcgaactgagggtgacagtcaggaaatggtacggctgctgcttcaggcaattcagagc
ttcgagaagaaagtgcgagtgatctatacacagctcagtaaaactgtggtttgcaagcag
aaggcgctggaactgttgcccaaggtggaagaggtggtgagcttaatgaatgaggatgag
aagactgttgtccggctgcaggagaagcggcagaaggagctctggaatctcctgaagatt
gcttgtagcaaggtccgtggtcctgtcagtggaagcccggatagcatgaatgcctctcga
cttagccagcctgggcagctgatgtctcagccctccacggcctccaacagcttacccgaa
ccagccaagaagagtgaagaactggtggccgaagcacataacctgtgcaccctgctagaa
aatgccatacaggacaccgtgagggagcaagaccagagtttcacggccctagactggagc
tggttacagacggaagaagaagagcacagctgcctggagcaggcctcctga

KEGG   Macaca mulatta (rhesus monkey): 709511
Entry
709511            CDS       T01028                                 

Gene name
CHUK
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha isoform X3
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01523  Antifolate resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04062  Chemokine signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04068  FoxO signaling pathway
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04380  Osteoclast differentiation
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04668  TNF signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc05010  Alzheimer disease
mcc05132  Salmonella infection
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05212  Pancreatic cancer
mcc05215  Prostate cancer
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
mcc05222  Small cell lung cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    709511 (CHUK)
   04014 Ras signaling pathway
    709511 (CHUK)
   04064 NF-kappa B signaling pathway
    709511 (CHUK)
   04668 TNF signaling pathway
    709511 (CHUK)
   04068 FoxO signaling pathway
    709511 (CHUK)
   04151 PI3K-Akt signaling pathway
    709511 (CHUK)
   04150 mTOR signaling pathway
    709511 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    709511 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    709511 (CHUK)
   04621 NOD-like receptor signaling pathway
    709511 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    709511 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    709511 (CHUK)
   04625 C-type lectin receptor signaling pathway
    709511 (CHUK)
   04660 T cell receptor signaling pathway
    709511 (CHUK)
   04658 Th1 and Th2 cell differentiation
    709511 (CHUK)
   04659 Th17 cell differentiation
    709511 (CHUK)
   04657 IL-17 signaling pathway
    709511 (CHUK)
   04662 B cell receptor signaling pathway
    709511 (CHUK)
   04062 Chemokine signaling pathway
    709511 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    709511 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    709511 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    709511 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    709511 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    709511 (CHUK)
   05221 Acute myeloid leukemia
    709511 (CHUK)
   05220 Chronic myeloid leukemia
    709511 (CHUK)
   05215 Prostate cancer
    709511 (CHUK)
   05222 Small cell lung cancer
    709511 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    709511 (CHUK)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    709511 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    709511 (CHUK)
   05135 Yersinia infection
    709511 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    709511 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    709511 (CHUK)
   05161 Hepatitis B
    709511 (CHUK)
   05160 Hepatitis C
    709511 (CHUK)
   05171 Coronavirus disease - COVID-19
    709511 (CHUK)
   05164 Influenza A
    709511 (CHUK)
   05162 Measles
    709511 (CHUK)
   05168 Herpes simplex virus 1 infection
    709511 (CHUK)
   05163 Human cytomegalovirus infection
    709511 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    709511 (CHUK)
   05169 Epstein-Barr virus infection
    709511 (CHUK)
   05165 Human papillomavirus infection
    709511 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    709511 (CHUK)
   05142 Chagas disease
    709511 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    709511 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    709511 (CHUK)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     709511 (CHUK)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   709511 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 709511
NCBI-ProteinID: XP_001107171
Ensembl: ENSMMUG00000018476
UniProt: G7N0X0 A0A1D5Q734
LinkDB
Position
9
AA seq 745 aa
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMSGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
VQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAVTPQTSVWLPPTSAEHDHSLSCVVTPQDGDTSAQMIEENLNCLGHL
STIIHEANEEQGNSMMNLDWSWLTE
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccgggcgcgggcgggccctgggagatgcgggagcgg
ttgggcaccggcggcttcgggaacgtctgtctgtaccagcatcgggaacttgatctcaaa
atagcaattaagtcttgtcgcctagagctaagtaccaaaaacagagaacgatggtgccac
gaaatccagattatgaagaagttgaaccatgccaacgttgtaaaggcctgtgatgttcct
gaagaattgaatattttgattcatgatgtgcctcttctagcaatggaatactgttctgga
ggagatctccgaaagctgctcaacaaaccagaaaattgttgtggacttaaagaaagccag
atactttctttactaagtgatatagggtctgggattcgatatttgcatgaaaacaaaatt
atacatcgagatctaaaacctgaaaacatagttcttcaggacgttggtggaaagataata
cataaaataattgatctgggatatgccaaagatgttgatcaaggaagtctgtgtacatct
tttgtgggaacactgcagtatctggccccagagctctttgagaataagccttacacagcc
actgttgattattggagctttgggaccatggtatttgaatgtattgctggatataggcct
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagagatgtcaggagaagttcggtttagtagccatttacctcaa
ccaaatagcctttgtagtttaatagtagaacccatggaaaactggctacagttgatgttg
aattgggaccctcagcagagaggaggacctgttgaccttactttgaagcagccaagatgt
tttgtactaatggatcacattttgaatttgaagatagtacacatcctaaatatgacttct
gcaaagataatttcttttctgttaccacctgatgaaagtcttcattcactacagtctcgt
attgagcgtgaaactggaataaatactggttctcaagaacttctttcagagacaggaatt
tctctggatcctcggaaaccagcctctcaatgtgttctagatggagttagaggctgtgat
agctatatggtttatttgtttgataaaagtaaaactgtgtatgaagggccatttgcttcc
agaagtttatctgattgtgtaaattatattgtacaggacagcaaaatacagcttccaatt
gtacagctgcgtaaagtgtgggctgaagcagtgcactatgtgtctggactaaaagaagac
tacagcaggctctttcagggacaaagggcagcaatgttaagtcttcttagatataatgct
aacttaacaaaaatgaagaacactttgatctcagcatcacaacaactgaaagctaaattg
gagttttttcacaaaagcattcagcttgacttggagagatacagcgagcagatgacgtat
gggatatcttcagaaaaaatgctaaaagcatggaaagaaatggaagaaaaggccatccac
tatgctgaggttggtgtcattggatacctggaggatcagattatgtctttgcatgctgaa
atcatggagctacagaagagcccctatggaagacgtcagggagacttgatggaatctctg
gaacagcgtgctattgatctatataagcagttaaaacacagaccttcagatcactcctac
agtgacagcacagagatggtgaaaatcattgtgcacactgtgcagagtcaggaccgtgtg
ctcaaggagctgtttggtcatttgagcaagttgttgggctgtaagcagaagattattgat
ctactccctaaggtggaagtggccctcagtaacatcaaagaagctgataatactgtcatg
ttcatgcagggaaaaaggcagaaagaaatatggcatctccttaaaattgcctgtacacag
agttctgcccggtcccttgtaggatccagtctagaaggtgcagtaacccctcagacgtca
gtatggctgcccccgacttcagcagaacatgatcattctctgtcatgtgtggtaactcct
caagatggggatacttcagcacaaatgatagaagaaaatttgaactgccttggccattta
agcactattattcatgaggcaaatgaggaacagggcaatagtatgatgaatcttgattgg
agttggttaacagaatga

DBGET integrated database retrieval system