KEGG   Macaca mulatta (rhesus monkey): 701295
Entry
701295            CDS       T01028                                 

Gene name
CASP10
Definition
(RefSeq) caspase-10
  KO
K04400  caspase 10 [EC:3.4.22.63]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04210  Apoptosis
mcc04622  RIG-I-like receptor signaling pathway
mcc04668  TNF signaling pathway
mcc05152  Tuberculosis
mcc05161  Hepatitis B
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    701295 (CASP10)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    701295 (CASP10)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    701295 (CASP10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    701295 (CASP10)
  09172 Infectious disease: viral
   05161 Hepatitis B
    701295 (CASP10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcc01002]
    701295 (CASP10)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.63  caspase-10
     701295 (CASP10)
Peptidases and inhibitors [BR:mcc01002]
 Cysteine peptidases
  Family C14: caspase family
   701295 (CASP10)
SSDB
Motif
Pfam: Peptidase_C14 DED Imm30
Other DBs
NCBI-GeneID: 701295
NCBI-ProteinID: XP_014966206
Ensembl: ENSMMUG00000031297
LinkDB
Position
12
AA seq 520 aa
MKSQGSSSDKNCKVSFRKKLLIIDSDLGVEDVERLKFLCIGLVPNKKLEKSSSASDVFEH
LLAEDLLSEGDSFFLAELLYIIGQKKLLQYLNYTEEKVEQLLPIQGKVSLFRNLLYELSQ
GIDSEDLKNMIFLLNDSLPKTEMTSLSFLALLEKQDKIDEDNLTCLEDLCKMVVPKLLRN
IEKYKREKAAQIATPPVDKEAESLYQGEEELVSQTDIKTFLEALPQEESQQDKHARSNGN
RATDGAPSLVSRGLQGASANTLNSETSTKWAPTYRMDRNHRGLCVIVNNHSFISLRDRRG
THKDAEILKGVFQWLGFTVHIYNNVTKGEMEEVLQKEKCNPAHADGDCFVFCILTHGEDG
AVYSSDEALIPIREIMSHFTALQCPGLAEKPKLFFIQACQGEKIQLSKSIEADALNPEQA
PTSLQDSIPVEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKVLVPRREDILSILTA
VNDDVSRRVDKQGTKKQMPQPAFTLRKKLVFPVPLDALSL
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgaaatctcaaggttccagttcagataaaaactgtaaagtgagctttcgtaagaagctt
ctgattattgattcagacttgggggtcgaagatgtggagcgcctcaagtttctctgcata
ggattggttcccaacaagaagctggagaaatccagctcggcctcagatgtttttgaacat
ctcttggcagaggatctgctgagtgagggagactctttcttcctggcggaactcctatat
atcatagggcagaagaagctgctgcagtacctcaactataccgaagagaaagtggagcaa
ttgctacctatccaaggaaaggtctctctatttagaaacctgctctacgaactgtcacaa
ggcattgactcagaggacttaaagaacatgatcttccttctgaacgactctcttcccaaa
accgaaatgacctccctgagtttcctggcacttctagagaaacaagataaaatagatgaa
gataatctgacatgcttggaggacctctgcaaaatggttgtacctaaacttttgagaaac
atagagaaatacaaaagagagaaagctgcccagatagcgacacctcctgtagacaaggaa
gctgagtcattgtatcaaggagaggaagaactagtttcccaaacagacattaaaacattc
ttggaagccttaccgcaggaggagtcccagcaagataagcatgcaaggagtaatggtaac
agagccacagatggtgcaccaagcctggtctccagggggttgcaaggagcatctgctaac
actctaaactctgaaaccagcacaaagtgggcacctacgtacaggatggatcggaaccac
agaggcctctgtgtcattgtcaacaaccacagctttatctccctgcgggacagacgagga
acccataaagatgctgagatcctgaagggtgtgttccagtggcttgggttcacagtgcat
atatacaataatgtgacgaaaggggaaatggaggaggtcctgcagaaggagaagtgcaat
ccagcccatgccgacggggactgcttcgtgttctgtattctgacccatggggaagacgga
gctgtctactcttcggatgaggccctcattcccattcgggaaatcatgtctcacttcaca
gccctgcagtgccctggactggctgaaaaacctaaactctttttcatccaggcctgccaa
ggtgaaaagatacagctttccaaatccatcgaagcagatgctctgaaccctgagcaggca
cccacttccctgcaggacagtattcccgtcgaggctgacttcctacttggtctggccact
gtcccaggctatgtatcctttcggcatgtggaggaaggcagctggtatattcaatctctg
tgtaatcatctgaaggtcttggtcccaagacgggaagacatcttatccatcctcactgct
gtcaacgatgatgtgagtcgacgagtggacaaacagggaacaaagaaacagatgccccag
cctgctttcacactaaggaaaaaactagtattccctgtgcccctggatgcactttcatta
tag

DBGET integrated database retrieval system