KEGG   Macaca mulatta (rhesus monkey): 701416Help
Entry
701416            CDS       T01028                                 

Gene name
CNIH3
Definition
(RefSeq) protein cornichon homolog 3 isoform X1
  KO
K20368  protein cornichon
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    701416 (CNIH3)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcc02000]
    701416 (CNIH3)
Membrane trafficking [BR:mcc04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    701416 (CNIH3)
Transporters [BR:mcc02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   701416 (CNIH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cornichon
Motif
Other DBs
NCBI-GeneID: 701416
NCBI-ProteinID: XP_001095178
Ensembl: ENSMMUG00000010335
UniProt: F6RG74
LinkDB All DBs
Position
1
AA seq 160 aa AA seqDB search
MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERI
CFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPP
VVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggccttcactttcgctgcgttctgctacatgctgtctctggtgctgtgcgctgcgctc
atcttcttcgccatctggcacataattgcctttgatgagttaaggacggattttaagagc
cccatagaccagtgcaaccctgttcatgcgagggaacggctgaggaacatcgagcgcatc
tgcttccttctgcgaaagctggtgctgccagaatactccatccatagcctcttctgcatc
atgttcctgtgtgcgcaagagtggctcacgctggggctgaatgtccctctacttttctat
cacttctggaggtatttccactgtccggcagacagctcagagctagcctacgacccaccg
gtggtcatgaatgccgacactttgagttactgtcagaaggaggcctggtgtaagctggcc
ttctatctcctctccttcttctactacctttactgcatgatctacactttagtgagctct
taa

DBGET integrated database retrieval system