KEGG   Macaca mulatta (rhesus monkey): 701456
Entry
701456            CDS       T01028                                 

Gene name
CISH
Definition
(RefSeq) cytokine-inducible SH2-containing protein
  KO
K04701  cytokine inducible SH2-containing protein
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04630  JAK-STAT signaling pathway
mcc04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    701456 (CISH)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    701456 (CISH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    701456 (CISH)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcc04990]
    701456 (CISH)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     701456 (CISH)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   701456 (CISH)
SSDB
Motif
Pfam: SH2 SOCS_box BCA_ABC_TP_C
Other DBs
NCBI-GeneID: 701456
NCBI-ProteinID: NP_001245004
UniProt: I0FP17
LinkDB
Position
2
AA seq 258 aa
MVLCVQGPRPLLAVERTGQRPLWAQSLELLETVMQPLPAGAFLEEVAEGTPAQIESEPKV
LDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTARGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDSPDPAP
TPALPMPKEDAPNDPALPAPPPATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVTDVDC
LPLPRRMADYLRQYPFQL
NT seq 777 nt   +upstreamnt  +downstreamnt
atggtcctctgcgttcagggacctcgtcctttgctggctgtggagcggactgggcagcgg
cccctgtgggcccagtccctagaactgctcgagacagtcatgcagcccttgcctgctggg
gccttcctggaggaggtggcagaggggaccccagcccagatagagagtgagccaaaggtg
ttggaccccgaggaggatctgctgtgcatagccaagaccttctcctaccttcgggaatct
ggctggtattggggttccattacggccagcgaggcccggcaacacctgcagaagatgcca
gagggcacgttcctagtacgtgacagcacccaccccagctacctgttcacgctgtcagtg
aaaactgctcgtggccccaccaatgtgcgcattgagtatgctgactccagcttccgtctg
gactccaactgcttgtccaggccacgcatcctggcctttccggatgtggtcagccttgtg
cagcactatgtggcctcctgcgctgctgacacccgaagcgacagccccgatcctgctccc
accccggccctgcctatgcctaaggaagatgcgcctaatgatccagcactgcctgctcct
ccaccagccactgctgtacacctaaaattggtgcagccctttgtacgcagaagcagtgcc
cgcagcctgcaacacctgtgccgccttgtcatcaaccgtctggtgaccgacgtggactgc
ctgccactgccccggcgcatggccgactacctccgacagtaccccttccagctctga

DBGET integrated database retrieval system