KEGG   Macaca mulatta (rhesus monkey): 701652Help
Entry
701652            CDS       T01028                                 

Gene name
MGST1
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00480  Glutathione metabolism
mcc00980  Metabolism of xenobiotics by cytochrome P450
mcc00982  Drug metabolism - cytochrome P450
mcc00983  Drug metabolism - other enzymes
mcc01524  Platinum drug resistance
mcc05200  Pathways in cancer
mcc05204  Chemical carcinogenesis
mcc05225  Hepatocellular carcinoma
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    701652 (MGST1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    701652 (MGST1)
   00982 Drug metabolism - cytochrome P450
    701652 (MGST1)
   00983 Drug metabolism - other enzymes
    701652 (MGST1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    701652 (MGST1)
   05204 Chemical carcinogenesis
    701652 (MGST1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    701652 (MGST1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    701652 (MGST1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    701652 (MGST1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcc02000]
    701652 (MGST1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     701652 (MGST1)
Transporters [BR:mcc02000]
 Other Transporters
  Pores ion channels [TC:1]
   701652 (MGST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 701652
NCBI-ProteinID: XP_015006694
Ensembl: ENSMMUG00000002359
UniProt: F7C0H2
LinkDB All DBs
Position
11
AA seq 155 aa AA seqDB search
MVDLTQIMDDEVFMAFASYATIILSKMMLMSATTAFYRMTRKVFANPEDCVTFGKGENAK
KYLRTDDRVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTAILHFRLFVGARIYHTIS
YLTPLPQPNRGLSFFIGYGVTLSMAYRLLKNKLYL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggttgacctcacccagataatggacgatgaagtattcatggcttttgcctcctatgca
acaattattctttcaaaaatgatgcttatgagtgctacaactgcattctatagaatgaca
agaaaggtttttgccaatccagaagactgtgtaacatttggcaaaggagaaaatgccaag
aagtatcttcgaacagatgacagagtagaacgtgtacgcagagcccacctgaatgacctt
gaaaatattgttccatttcttggaattggcctcctgtattccttgagtggtcccgacctc
tctacagccatcctgcacttcagactctttgtcggagcacggatctaccacaccatttcg
tatttgacaccccttccccagccaaatagaggtttgagtttttttattggatatggagtt
actctttccatggcttacaggttgctgaaaaataaattgtacctgtaa

DBGET integrated database retrieval system