KEGG   Macaca mulatta (rhesus monkey): 701760
Entry
701760            CDS       T01028                                 

Gene name
PCYT1B
Definition
(RefSeq) choline-phosphate cytidylyltransferase B
  KO
K00968  choline-phosphate cytidylyltransferase [EC:2.7.7.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00440  Phosphonate and phosphinate metabolism
mcc00564  Glycerophospholipid metabolism
mcc01100  Metabolic pathways
mcc05231  Choline metabolism in cancer
Module
mcc_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    701760 (PCYT1B)
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    701760 (PCYT1B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    701760 (PCYT1B)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.15  choline-phosphate cytidylyltransferase
     701760 (PCYT1B)
SSDB
Motif
Pfam: CTP_transf_like Lipoprotein_6 YtxH
Other DBs
NCBI-GeneID: 701760
NCBI-ProteinID: NP_001245121
Ensembl: ENSMMUG00000012821
UniProt: A0A1D5RCC8 G7NSP9
LinkDB
Position
X
AA seq 369 aa
MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCRAPHE
KLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHK
FKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDD
VYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKRY
RFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWK
QMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISS
MSEGDEDEK
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgccagtagttaccactgatgctgagtcagaaacaggtatcccaaaatccctttccaat
gagcctccctcagaaaccatggaggaaatagagcacacatgcccacagcctcgactgacc
ctgaccgcacctgccccatttgctgatgaaaccaactgccagtgtcgagcaccccatgaa
aaactgaccattgctcaggcccgcttaggaacaccagctgacaggcctgtcagagtatac
gccgatggaatatttgacctcttccactcgggtcatgcaagggcccttatgcaagcaaaa
acactgtttcccaacagctacttgttggtaggagtttgcagtgatgatctcacccacaaa
ttcaaaggtttcactgtgatgaatgaagccgagagatacgaagctctcagacactgtcgc
tacgtagacgaagtaatcagagatgctccctggacactcacgccagagtttctggaaaaa
cacaagattgattttgtggctcatgatgacattccgtattcctctgctggctctgatgat
gtttacaagcacataaaggaagcagggatgttcgttccaacacagagaacagaaggcatc
tcaacatcggacatcattaccagaattgttcgtgactatgatgtttatgcccgacgtaac
ctccagagagggtatacagccaaggaactgaatgtcagctttataaatgagaagaggtac
cgtttccagaaccaggtggacaaaatgaaggaaaaagtcaagaatgtggaggaaagatca
aaggaatttgtgaacagagtggaagaaaagagccatgatctaattcaaaagtgggaagag
aagtcaagagaattcattggcaacttcctagaactgtttggacctgatggagcatggaag
cagatgttccaagagaggagcagccggatgctgcaggccttgtccccgaagcagagccct
gtgagcagcccaacccggagccggtccccttcccgctccccatcgcccaccttctcatgg
cttccactcaaaacctcacccccttcctcacccaaagcagcctcggcctccatcagcagc
atgagtgagggggatgaggatgagaagtag

KEGG   Macaca mulatta (rhesus monkey): 722105
Entry
722105            CDS       T01028                                 

Gene name
PCYT1A
Definition
(RefSeq) choline-phosphate cytidylyltransferase A
  KO
K00968  choline-phosphate cytidylyltransferase [EC:2.7.7.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00440  Phosphonate and phosphinate metabolism
mcc00564  Glycerophospholipid metabolism
mcc01100  Metabolic pathways
mcc05231  Choline metabolism in cancer
Module
mcc_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    722105 (PCYT1A)
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    722105 (PCYT1A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    722105 (PCYT1A)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.15  choline-phosphate cytidylyltransferase
     722105 (PCYT1A)
SSDB
Motif
Pfam: CTP_transf_like DUF1664 hNIFK_binding YtxH
Other DBs
NCBI-GeneID: 722105
NCBI-ProteinID: XP_028699363
Ensembl: ENSMMUG00000038924
LinkDB
Position
2
AA seq 367 aa
MDAQCSAKVNARKRRKEAPGPNGATEEDGVPFKVQRCAVGLRKPAPFSDEIEVDFSKPYV
RVTMEEASRGTPCERPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHN
FKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDD
VYKHIKEAGMFAPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKKY
HLQERVDKVKKKVKDVEEKSKEFVQKVEEKSIDLIQKWEEKSREFIGSFLEMFGPEGALK
HMLKEGKGRMLQAISPKQSPSSSPTRERSPSPSFRWPFSGKTSPPCSPANLPRHKAAAYD
ISEDEED
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggatgcacagtgttcagccaaggtcaatgcaaggaagaggaggaaagaggcgcctgga
cccaacggggcaacagaggaagatggggttcctttcaaagtgcagcgctgtgcagtgggc
ttacggaaaccagctcctttttctgatgaaattgaagttgactttagtaagccctatgtc
agggtaactatggaggaagccagcagaggaactccttgtgagcgacctgtgagagtttac
gccgatggaatatttgacttatttcactctggtcatgcccgagctctgatgcaagcaaag
aaccttttccctaatacgtacctcattgtgggagtttgcagtgatgagctcacacacaac
ttcaaaggcttcacggtgatgaatgagaacgagcgctatgacgcagtccagcactgccgt
tatgtggatgaggtggtgaggaatgcgccctggaccctgacacctgagttcctggccgaa
caccggattgattttgtagcccatgatgatatcccttattcatctgctggaagtgatgat
gtttataagcacatcaaggaggcaggcatgtttgctccaacacagaggacagaaggtatc
tccacgtcagacatcatcacccgaattgtgcgggactatgatgtgtatgcgaggcggaac
ctgcagaggggctacacggcaaaggagctcaatgtcagcttcatcaacgagaagaaatac
cacttgcaggagagggttgacaaagtaaagaagaaagtgaaagacgtggaggaaaagtcc
aaagaatttgttcagaaggtggaggaaaaaagcattgacctcattcagaagtgggaggag
aagtcccgagaattcattggaagttttctggaaatgtttggtccggaaggagcgctgaaa
cacatgctgaaagaggggaagggccggatgctgcaggccatcagtccaaagcagagcccc
agcagcagccccactcgcgagcgctctccctccccctcttttcgatggcccttctctggc
aagacttccccaccttgttccccagcaaatctccccaggcacaaggctgcagcctatgat
atcagtgaggatgaagaagactaa

DBGET integrated database retrieval system