KEGG   Macaca mulatta (rhesus monkey): 701822
Entry
701822            CDS       T01028                                 

Gene name
CDK6
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04110  Cell cycle
mcc04115  p53 signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04218  Cellular senescence
mcc04934  Cushing syndrome
mcc05160  Hepatitis C
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05206  MicroRNAs in cancer
mcc05212  Pancreatic cancer
mcc05214  Glioma
mcc05218  Melanoma
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    701822 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    701822 (CDK6)
   04115 p53 signaling pathway
    701822 (CDK6)
   04218 Cellular senescence
    701822 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    701822 (CDK6)
   05206 MicroRNAs in cancer
    701822 (CDK6)
   05203 Viral carcinogenesis
    701822 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    701822 (CDK6)
   05225 Hepatocellular carcinoma
    701822 (CDK6)
   05214 Glioma
    701822 (CDK6)
   05220 Chronic myeloid leukemia
    701822 (CDK6)
   05218 Melanoma
    701822 (CDK6)
   05224 Breast cancer
    701822 (CDK6)
   05222 Small cell lung cancer
    701822 (CDK6)
   05223 Non-small cell lung cancer
    701822 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    701822 (CDK6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    701822 (CDK6)
   05164 Influenza A
    701822 (CDK6)
   05162 Measles
    701822 (CDK6)
   05163 Human cytomegalovirus infection
    701822 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    701822 (CDK6)
   05169 Epstein-Barr virus infection
    701822 (CDK6)
   05165 Human papillomavirus infection
    701822 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    701822 (CDK6)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     701822 (CDK6)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CMGC group
  CDK family
   701822 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 701822
NCBI-ProteinID: NP_001248236
Ensembl: ENSMMUG00000008698
UniProt: H9EMN3 G7MLW4
LinkDB
Position
3
AA seq 326 aa
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacggcctgtgccgcgctgaccagcagtacgaatgcgtggcggagatcggg
gagggcgcctatgggaaggtgttcaaggcccgcgacttgaagaacggaggccgtttcgtg
gcgttgaagcgcgtgcgggtgcagacgggcgaggagggcatgccgctctccaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gatgtgtgcacagtgtcacgaacagacagagaaaccaaactaactttagtgtttgaacat
gtcgatcaagacttgaccacttacttggataaagttccagagcctggagtgcccactgaa
accataaaggatatgatgtttcagcttctccgaggtctggactttcttcattcacaccga
gtagtgcatcgcgatctaaaaccacagaacattctggtgaccagcagcggacaaataaaa
ctcgctgacttcggccttgcccgcatctatagtttccagatggctctaacctcagtggtc
gtcacgctgtggtacagagctcccgaagtcttgctgcagtccagctacgccacccccgtg
gatctatggagtgttggctgcatatttgcagaaatgtttcgtagaaagcctctttttcgt
ggaagttcagatgtcgatcaactaggaaaaatcttggacgtaattggactcccaggagaa
gaagactggcctagagatgttgcccttcccaggcaggcttttcattcaaaatctgcccaa
ccaattgagaagtttgtaacagatatcgatgaactaggcaaagacctacttctgaagtgt
ttgacatttaacccagccaaaagaatatcagcctacagtgccctgtctcacccatacttc
caggacctggagaggtgcaaagaaaacctggattcccacctgccgcccagccagaacacc
tcggagctgaatacagcctga

KEGG   Macaca mulatta (rhesus monkey): 715650
Entry
715650            CDS       T01028                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04110  Cell cycle
mcc04115  p53 signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04218  Cellular senescence
mcc04530  Tight junction
mcc04660  T cell receptor signaling pathway
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04934  Cushing syndrome
mcc05160  Hepatitis C
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05212  Pancreatic cancer
mcc05214  Glioma
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    715650 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    715650 (CDK4)
   04115 p53 signaling pathway
    715650 (CDK4)
   04218 Cellular senescence
    715650 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    715650 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    715650 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    715650 (CDK4)
   05203 Viral carcinogenesis
    715650 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    715650 (CDK4)
   05225 Hepatocellular carcinoma
    715650 (CDK4)
   05214 Glioma
    715650 (CDK4)
   05220 Chronic myeloid leukemia
    715650 (CDK4)
   05218 Melanoma
    715650 (CDK4)
   05219 Bladder cancer
    715650 (CDK4)
   05224 Breast cancer
    715650 (CDK4)
   05222 Small cell lung cancer
    715650 (CDK4)
   05223 Non-small cell lung cancer
    715650 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    715650 (CDK4)
   04934 Cushing syndrome
    715650 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    715650 (CDK4)
   05160 Hepatitis C
    715650 (CDK4)
   05164 Influenza A
    715650 (CDK4)
   05162 Measles
    715650 (CDK4)
   05163 Human cytomegalovirus infection
    715650 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    715650 (CDK4)
   05169 Epstein-Barr virus infection
    715650 (CDK4)
   05165 Human papillomavirus infection
    715650 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    715650 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    715650 (CDK4)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     715650 (CDK4)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CMGC group
  CDK family
   715650 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 715650
NCBI-ProteinID: NP_001248276
UniProt: I0FIZ0 G7N7H3
LinkDB
Position
11
AA seq 303 aa
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctacctctcgatatgagccagtggctgaaattggtgtcggtgcctatgggacagtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtcccc
aatggaggaggagctggaggaggccttcccatcagcacagttcgggaggtggccttactg
aggcgactggaggcttttgaacatcccaatgtagtccggctgatggacgtctgtgccaca
tcccgaactgaccgggagatcaaggtaaccctggtgtttgagcatgtagaccaagaccta
aggacgtatctggacaaagcacccccaccaggcttgccagccgagaccatcaaggatttg
atgcgccagtttctaagaggcctagatttccttcatgcaaattgcatcgttcaccgagat
ctgaagccagagaacattctggtgacaagtggtggaacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacccgtggttgttacactctggtac
cgagctcccgaagttcttctgcagtccacatatgcaacacctgtggacatgtggagtgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttgggcaaaatctttgacctgattgggctgcctccagaggatgactggcctcga
gatgtatccctgccccgtggagcctttccccccagagggccccgcccagtgcagtcggtg
gtacctgagatggaggagtcgggagcacagctgctgctggaaatgctgacttttaaccca
cacaagcgaatctctgcctttcgagctctgcagcactcttatctacataaggatgaaggt
aatccggagtga

DBGET integrated database retrieval system