KEGG   Macaca mulatta (rhesus monkey): 701951
Entry
701951            CDS       T01028                                 

Gene name
PLCB2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00562  Inositol phosphate metabolism
mcc01100  Metabolic pathways
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04062  Chemokine signaling pathway
mcc04070  Phosphatidylinositol signaling system
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04310  Wnt signaling pathway
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04613  Neutrophil extracellular trap formation
mcc04621  NOD-like receptor signaling pathway
mcc04713  Circadian entrainment
mcc04720  Long-term potentiation
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04728  Dopaminergic synapse
mcc04730  Long-term depression
mcc04742  Taste transduction
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04919  Thyroid hormone signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04929  GnRH secretion
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04961  Endocrine and other factor-regulated calcium reabsorption
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc04973  Carbohydrate digestion and absorption
mcc05010  Alzheimer disease
mcc05016  Huntington disease
mcc05017  Spinocerebellar ataxia
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05142  Chagas disease
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05163  Human cytomegalovirus infection
mcc05200  Pathways in cancer
Module
mcc_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    701951 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    701951 (PLCB2)
   04310 Wnt signaling pathway
    701951 (PLCB2)
   04371 Apelin signaling pathway
    701951 (PLCB2)
   04020 Calcium signaling pathway
    701951 (PLCB2)
   04070 Phosphatidylinositol signaling system
    701951 (PLCB2)
   04072 Phospholipase D signaling pathway
    701951 (PLCB2)
   04071 Sphingolipid signaling pathway
    701951 (PLCB2)
   04022 cGMP-PKG signaling pathway
    701951 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    701951 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    701951 (PLCB2)
   04613 Neutrophil extracellular trap formation
    701951 (PLCB2)
   04621 NOD-like receptor signaling pathway
    701951 (PLCB2)
   04062 Chemokine signaling pathway
    701951 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    701951 (PLCB2)
   04922 Glucagon signaling pathway
    701951 (PLCB2)
   04929 GnRH secretion
    701951 (PLCB2)
   04912 GnRH signaling pathway
    701951 (PLCB2)
   04915 Estrogen signaling pathway
    701951 (PLCB2)
   04921 Oxytocin signaling pathway
    701951 (PLCB2)
   04926 Relaxin signaling pathway
    701951 (PLCB2)
   04935 Growth hormone synthesis, secretion and action
    701951 (PLCB2)
   04918 Thyroid hormone synthesis
    701951 (PLCB2)
   04919 Thyroid hormone signaling pathway
    701951 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    701951 (PLCB2)
   04916 Melanogenesis
    701951 (PLCB2)
   04924 Renin secretion
    701951 (PLCB2)
   04925 Aldosterone synthesis and secretion
    701951 (PLCB2)
   04927 Cortisol synthesis and secretion
    701951 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    701951 (PLCB2)
   04270 Vascular smooth muscle contraction
    701951 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    701951 (PLCB2)
   04971 Gastric acid secretion
    701951 (PLCB2)
   04972 Pancreatic secretion
    701951 (PLCB2)
   04973 Carbohydrate digestion and absorption
    701951 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    701951 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    701951 (PLCB2)
   04725 Cholinergic synapse
    701951 (PLCB2)
   04728 Dopaminergic synapse
    701951 (PLCB2)
   04726 Serotonergic synapse
    701951 (PLCB2)
   04720 Long-term potentiation
    701951 (PLCB2)
   04730 Long-term depression
    701951 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    701951 (PLCB2)
  09157 Sensory system
   04742 Taste transduction
    701951 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    701951 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    701951 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    701951 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    701951 (PLCB2)
   05016 Huntington disease
    701951 (PLCB2)
   05017 Spinocerebellar ataxia
    701951 (PLCB2)
   05022 Pathways of neurodegeneration - multiple diseases
    701951 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    701951 (PLCB2)
   04934 Cushing syndrome
    701951 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    701951 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    701951 (PLCB2)
   05142 Chagas disease
    701951 (PLCB2)
   05143 African trypanosomiasis
    701951 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    701951 (PLCB2)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     701951 (PLCB2)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    701951 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    701951 (PLCB2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 IATP AAA_13 Gp58
Other DBs
NCBI-GeneID: 701951
NCBI-ProteinID: NP_001253955
Ensembl: ENSMMUG00000020535
UniProt: H9YV70
LinkDB
Position
7
AA seq 1185 aa
MSLLNPVLLPPRVKAYLSQGERFIKWDDETTIASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKVWAEDILALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPEPVYKSFLMSLCPRPEINEIFTSYHAKAKPYMTKEH
LTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINVQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKM
AEYCRTIFGDMLLTEPLEKFPLKPGVPLPSPEDLRGKILIKNKKNQFSSPTSSSKDPGGE
AEGSSPRSAPAGEGTVWAGEEGTELEDEEVEEEEEEESGNLDEEEIKKMQSDEGTAGLEV
TAYEEMSSLVNYIQPTKFISFEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQM
SRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMAVFEFNGQSGYLLKHEF
MRRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRT
KLSPSTNSINPVWKEEPFVFEKILVPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHL
CLHSESNMPLTMPALFVFLEMKDYVPGAWADLTVALANPIKFFSAHDKRSVKLKDIMGGL
PEKPFPLASPVASQVNGALAPRSNGSPAARAWAREEAMKEVAEPRTASLEELRELKGVVK
LQRRHEKELRELERRGARRWEELLQRGAAQLAELGPRGAGGGGAGKLGPGKGSRKKRSLP
CEESAGAAPGESPEGMDARVRELKDRLELELLRQGEEQYECVLKRKEQHAAEQISKMMEL
AREKQAAELKALKETAEIDTKEMKKKLETKRLERIQGMTKVTADKMAQERLKREINSSHI
QEVVQVIKQMTENLEKHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKE
SVRACFRTCFPSETKDKPERDCECPPELCEQDPVVAKTDVQESRL
NT seq 3558 nt   +upstreamnt  +downstreamnt
atgtctctgctcaaccctgtgctgctgccccccagggtgaaggcctatctgagccaaggg
gagcgcttcatcaaatgggatgatgaaactacaattgcctctccagttatcctccgtgtg
gatcctaagggctactacttatactggacatatcaaagcaaggagatggagtttctggat
atcaccagcatccgggacactcgctttgggaagtttgccaagatgcccaagagccagaag
ctccgggacgtcttcaacatggactttcctgacaacagcttcctgctgaagacgctcacc
gtggtgtctggcccggacatggtggacctcaccttccacaacttcgtctcctacaaggag
aacgtgggcaaggtctgggctgaggacatactggccctagtcaagcatccgctgacggcc
aacgcctcccgcagcaccttcctggacaagatcctcgtgaagctcaagatgcagctcaac
tctgaagggaagattccagtgaagaactttttccagatgtttcctgctgaccgcaagcgg
gtggaagctgctctcagtgcctgccacctccctaaaggcaagaatgacgccatcaatcct
gaggacttcccagaacctgtctacaagagtttcctcatgagcctctgtcctcggccagaa
ataaatgagatcttcacttcttaccatgctaaggccaaaccctacatgacgaaggagcac
ttgaccaaattcatcaaccagaaacagcgggactcccggcttaactccctgctgttcccg
ccagcacggcctgaccaggtgcagggcctcatcgacaagtatgagcccagtggcatcaat
gtgcagaggggccagttgtcacctgagggcatggtctggtttctctgtgggccagagaac
agtgtgctggcccaggacaagctgctgctccaccacgacatgacacagccactcaatcat
tacttcatcaactcgtcccacaacacctacctgacagccggccagttctcaggcctctcc
tcggctgagatgtaccgccaggtgctgctgtccggctgccgttgcgtggagctagattgc
tggaaggggaaaccccctgacgaagagcccattatcacccacggcttcaccatgaccaca
gacatcttcttcaaagaagcaattgaggctattgcagaaagcgcctttaagacctccccg
tatcctatcatcctgtcgtttgagaaccatgtggactcaccccgccagcaggctaagatg
gctgagtattgccggacgatctttggggatatgctgctcacagagcccctggaaaagttc
ccactgaaaccaggtgtccccctgcccagccctgaggatctcaggggcaagatcctcatc
aagaacaagaagaaccagttttccagccccacctcctccagtaaggatcctggtggggag
gctgagggcagcagcccacgcagtgcccctgcaggtgagggcacagtgtgggctggcgag
gaagggactgagctggaggacgaggaggtggaagaggaagaggaggaggagtcaggaaac
ctggacgaagaagagattaagaagatgcagtcggatgagggcacagcgggcctggaagtg
acggcttatgaggagatgtccagcctagtcaattacattcagcccaccaagttcatctcc
tttgagttctctgctcaaaagaaccgaagttatgtcatctcgtccttcacagaactcaag
gcatatgacctgctctccaaggcctcggtgcagtttgtggactacaacaagcgccagatg
agccgcatttaccccaagggaacccgcatggactcctccaactacatgccccagatgttc
tggaatgctggatgccagatggttgccctcaacttccagacgatggacttgcccatgcag
cagaacatggcagtgtttgagttcaatgggcagagcggctacctcctcaagcacgagttc
atgcgccggccggacaagcagttcaaccccttctcagtggaccgcatcgacgtggtggtg
gccaccaccctttctatcacggtgatctctgggcagttcctgtcagaacgcagtgtgcgc
acctatgtggaagtggagctgtttggccttcctggggaccccaagaggcgctaccgaact
aagctgtcacccagtaccaattccatcaatcctgtctggaaggaggagccctttgtcttt
gagaagatcttggtgcctgagctggcctctctcagggtggctgtgatggaggaaggcaac
aagtttcttggacaccgcatcatccccatcaatgccctaaattctgggtaccaccacctg
tgcctacacagtgagagcaacatgcccctcaccatgcctgcgctcttcgtcttcctggag
atgaaggactacgtacctggtgcctgggcagatctcactgtggccctcgccaaccccatc
aagttcttcagtgcccatgacaagaggtctgtgaagctcaaggacatcatgggagggctg
cctgagaagcccttcccactggcgagtccagttgccagccaggtcaatggtgcgttggcc
ccaaggagcaatgggtcaccagcagccagggcctgggccagggaagaggctatgaaagaa
gttgcggagccacggaccgccagcctggaggagctccgggagctaaagggcgtcgtgaag
ctgcagcggcggcacgagaaggagctgcgggagttggagcggcgcggagcgcggcgctgg
gaggagctgctgcagcggggcgcggcgcagctggccgagctcgggccacggggcgcgggg
ggtggcggggccggcaagctcggcccgggcaaaggctctcgcaagaagaggagcctgcct
tgcgaggagagcgccggagccgcgccgggcgagagccctgagggcatggacgcgcgcgtg
cgggagctgaaggacaggctggagctggagctgctgcggcagggcgaggagcagtacgag
tgcgttctgaagcgcaaggagcagcacgcggccgagcaaatctccaaaatgatggagctg
gccagagagaaacaggcggcagagctgaaggccctgaaggagacggcggagatcgacacc
aaagagatgaagaaaaagctggagaccaagagactggagcggatccagggcatgaccaaa
gtcaccgcagataagatggcccaggagaggttgaagagagagattaacagctcccacatc
caggaagtagtgcaggtgatcaagcagatgacagagaacttggagaagcaccaggagaag
ctggaagagaagcaggctgcttgcctggaacagatacgggagatggaaaagcagttccag
aaggaggcgctggcagagtacgaggccaggatgaagggtctggaggcagaggtgaaggag
tcggtgagggcctgcttcaggacctgctttccctctgagaccaaggacaagcctgagagg
gactgcgagtgccccccagagctgtgtgagcaggacccagtcgtagcaaagacagatgtc
caggagagccgcctttga

KEGG   Macaca mulatta (rhesus monkey): 717764
Entry
717764            CDS       T01028                                 

Gene name
PLCB3
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00562  Inositol phosphate metabolism
mcc01100  Metabolic pathways
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04062  Chemokine signaling pathway
mcc04070  Phosphatidylinositol signaling system
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04310  Wnt signaling pathway
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04613  Neutrophil extracellular trap formation
mcc04621  NOD-like receptor signaling pathway
mcc04713  Circadian entrainment
mcc04720  Long-term potentiation
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04728  Dopaminergic synapse
mcc04730  Long-term depression
mcc04742  Taste transduction
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04919  Thyroid hormone signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04929  GnRH secretion
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04961  Endocrine and other factor-regulated calcium reabsorption
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc04973  Carbohydrate digestion and absorption
mcc05010  Alzheimer disease
mcc05016  Huntington disease
mcc05017  Spinocerebellar ataxia
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05142  Chagas disease
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05163  Human cytomegalovirus infection
mcc05200  Pathways in cancer
Module
mcc_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    717764 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    717764 (PLCB3)
   04310 Wnt signaling pathway
    717764 (PLCB3)
   04371 Apelin signaling pathway
    717764 (PLCB3)
   04020 Calcium signaling pathway
    717764 (PLCB3)
   04070 Phosphatidylinositol signaling system
    717764 (PLCB3)
   04072 Phospholipase D signaling pathway
    717764 (PLCB3)
   04071 Sphingolipid signaling pathway
    717764 (PLCB3)
   04022 cGMP-PKG signaling pathway
    717764 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    717764 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    717764 (PLCB3)
   04613 Neutrophil extracellular trap formation
    717764 (PLCB3)
   04621 NOD-like receptor signaling pathway
    717764 (PLCB3)
   04062 Chemokine signaling pathway
    717764 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    717764 (PLCB3)
   04922 Glucagon signaling pathway
    717764 (PLCB3)
   04929 GnRH secretion
    717764 (PLCB3)
   04912 GnRH signaling pathway
    717764 (PLCB3)
   04915 Estrogen signaling pathway
    717764 (PLCB3)
   04921 Oxytocin signaling pathway
    717764 (PLCB3)
   04926 Relaxin signaling pathway
    717764 (PLCB3)
   04935 Growth hormone synthesis, secretion and action
    717764 (PLCB3)
   04918 Thyroid hormone synthesis
    717764 (PLCB3)
   04919 Thyroid hormone signaling pathway
    717764 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    717764 (PLCB3)
   04916 Melanogenesis
    717764 (PLCB3)
   04924 Renin secretion
    717764 (PLCB3)
   04925 Aldosterone synthesis and secretion
    717764 (PLCB3)
   04927 Cortisol synthesis and secretion
    717764 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    717764 (PLCB3)
   04270 Vascular smooth muscle contraction
    717764 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    717764 (PLCB3)
   04971 Gastric acid secretion
    717764 (PLCB3)
   04972 Pancreatic secretion
    717764 (PLCB3)
   04973 Carbohydrate digestion and absorption
    717764 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    717764 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    717764 (PLCB3)
   04725 Cholinergic synapse
    717764 (PLCB3)
   04728 Dopaminergic synapse
    717764 (PLCB3)
   04726 Serotonergic synapse
    717764 (PLCB3)
   04720 Long-term potentiation
    717764 (PLCB3)
   04730 Long-term depression
    717764 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    717764 (PLCB3)
  09157 Sensory system
   04742 Taste transduction
    717764 (PLCB3)
   04750 Inflammatory mediator regulation of TRP channels
    717764 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    717764 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    717764 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    717764 (PLCB3)
   05016 Huntington disease
    717764 (PLCB3)
   05017 Spinocerebellar ataxia
    717764 (PLCB3)
   05022 Pathways of neurodegeneration - multiple diseases
    717764 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    717764 (PLCB3)
   04934 Cushing syndrome
    717764 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    717764 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    717764 (PLCB3)
   05142 Chagas disease
    717764 (PLCB3)
   05143 African trypanosomiasis
    717764 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    717764 (PLCB3)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     717764 (PLCB3)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    717764 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    717764 (PLCB3)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 BPL_N
Other DBs
NCBI-GeneID: 717764
NCBI-ProteinID: XP_014969380
Ensembl: ENSMMUG00000012948
LinkDB
Position
14
AA seq 1234 aa
MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPSGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVSGPDPVNTVFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSADMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQVLLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSTGGPDS
AGRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEGALEKPSLEPRKSLGE
EGLNRGPYALGPADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQAGQEMCQDTQSQQL
GSQLSPNPTPSPLDASPRRPPGPTASPASTSLSSPGQRDDLIASILSEVAPTPLDELRGH
KALVKLQSRQERDLRELRKKHQRKAVTLTRRLLDGLAQAQAEGRCRLRPGALGGAADVED
TKEGEDEAKRYQEFQNRQVQSLLELREAQVDAEAQRRLEHLRQALQRLREVVLDANTTQF
KRLKEMNEREKKELQKILDRKRHNSISEAKTRDKHKKEAELTEINRRHITESVNSIRRLE
EAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGEMPEGLG
DGLLVACASNGHAPGSSGHLSGADSESQEENTQL
NT seq 3705 nt   +upstreamnt  +downstreamnt
atggcgggcgcccagcccggcgtccacgcgctgcagctggagccgcctaccgtggtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggagacctccagtcggaacctg
gtgaccctgcgtgtggaccccagtggcttcttcttgtactggacaggccccaacatggag
gtggacacactggacatcagttccatcagggacacacggacaggccggtacgcccgtctg
cccaaggaccccaagatccgggaagttctgggctttgggggtcccgatgcccggctggag
gagaagctgatgacggtggtgtctgggccggacccagtgaacacagtgttcttgaacttc
atggccgtgcaggatgacacagccaaggtctggtccgaggagctgttcaagctggctatg
aacatcctggctcagaacgcctcccggaacaccttcctgcgcaaagcatacacaaagctg
aagctgcaggtgaaccaggatggtcggatccccgtcaagaacatcctgaagatgttctca
gcagacaagaagcgggtggagactgcactggaatcctgtggcctcaatttcaaccggagt
gagtccatccggcctgatgagttttccttggaaatctttgagcggttcctgaacaagctg
tgtctgcggccggacattgacaagatcctgctggagataggtgccaagggcaagccatac
ctgacactggagcagctcatggacttcatcaaccagaagcaacgcgacccgagactcaac
gaagtgctgtacccgccgctgcggccctcccaggcccgactgctcatcgaaaagtatgag
cccaaccagcagtttctggagcgagaccagatgtccatggagggctttagccgctacctg
ggaggcgaggagaacggcatcctgcccctggaagccctggatctgagcgccgacatgacc
cagccgctgagtgcctacttcatcaactcctcgcataacacctatctcactgctgggcag
ctggccgggacctcgtcggtggagatgtaccgccaggtgctgctgtggggctgccgctgt
gtggagctggatgtgtggaaaggacggccgcccgaggaggaacccttcatcacccatggc
ttcaccatgaccacggaggtgcctctgcgcgacgtgctggaggccattgccgagactgcc
ttcaagacctcgccctaccccgtcatcctctcctttgagaaccacgtggactcggcaaag
cagcaggcaaagatggctgagtactgccgctccatctttggagatgcgctactcatcgag
cctctggacaagtacccgctggccccaggtgttcccctgcccagcccccaggacctgatg
ggccgtatcctggtgaagaacaagaagcggcacagacccagcacaggtggcccagacagc
gccgggcgcaagcggccgctggagcagagcaattcggccctgagcgagagctccgctgcc
actgagccctcctccccgcagcttgggtcgcccagctctgacagctgcccaggcctgagc
aacggggaggagggggcccttgagaagcccagcctggagcctcggaagtctttgggtgag
gagggcctgaaccggggcccctatgctcttggacctgctgaccgtgaggatgaggaggaa
gatgaggaagaggaggagcagacagaccccaaaaagccgaccacagatgagggcacggcc
agcagcgaggtgaatgccactgaggagatgtccacgcttgtcaactacatcgagcctgtc
aagttcaagtcctttgaagctgctcgaaagaggaacaaatgcttcgagatgtcgtccttc
gtggagaccaaggccatggagcaactgaccaagagccccatggagtttgtggaatacaac
aagcagcagctcagccgcatctaccccaagggcacccgcgtggactcctccaactacatg
ccccagctcttctggaacgtagggtgccagcttgttgcgctcaacttccagaccctcgat
gtggcgatgcagctcaatgcgggcgtttttgagtacaacgggcgcagcgggtacctgctc
aagccggagttcatgcggcggcctgacaaatccttcgaccccttcactgaggtcatcgtg
gatggcatcgtggccaatgccttgcgggtcaaggtgatctcggggcagttcctatccgac
aggaaggtgggcatctacgtggaggtggacatgtttggcctccctgttgacacgcggcgc
aagtaccgcacccggacctctcaggggaactcgttcaaccccgtgtgggatgaggagccc
ttcgacttccccaaggtggtgctgcctacgttggcttcacttcgaatcgcagcctttgag
gaggggggtaaatttgtagggcaccggatcctgcctgtctctgccatccgctctgggtac
cactatgtctgcctgcggaacgaggccaaccagccgctgtgccttccggccctgctcatc
tacactgaagcctcggactacattcctgatgaccaccaggactacgcggaggccctgatc
aaccccattaagcacgtcagcctgatggaccagagggcccggcagctggccgccctcatt
ggggagagtgaggctcaggctggccaagagatgtgccaggacacccagtctcagcagctg
gggtctcagctgtccccaaaccccacccctagcccactggatgcctccccccgccggccc
cccggccccaccgcctcccctgccagcacctccctcagcagcccagggcagcgcgacgat
ctcatcgccagcatcctctcagaggtggcccccaccccgctggatgagctccgaggtcac
aaggctctggtcaagctccagagccggcaagagcgagacctgcgggagctgcgcaagaag
catcagcggaaggcagtcaccctcacccgccgcctgctggatggcctggctcaggcacag
gctgagggcaggtgccggctgcggccaggtgccctaggcggggccgctgatgtggaggac
acgaaggagggggaggacgaggcaaagcggtatcaggagttccagaacagacaggtgcag
agcctgctggagctgcgggaggcccaggtggacgcagaggcccagcggaggctggagcat
ctgagacaggctctgcagcggctcagggaggtcgtccttgatgcaaacacaactcagttc
aagaggctgaaagagatgaacgagagggaaaagaaggaactgcagaagatcctggacaga
aagcgccataacagcatctcggaggccaagacgagggacaagcataagaaggaggcggaa
ctgacggagattaaccgtcggcacatcactgagtcagtcaactccatccgtcggctggag
gaggcccagaagcagcggcatgaccgtcttgtggctgggcagcagcaggtcctgcaacag
ctggcagaagaggagcccaagctgctggcccagctggcccaggagtgtcaggagcagcgg
gcgaggctcccccaggagatccgcaggagcctgctgggcgagatgccggaggggctgggg
gatgggcttctggtggcctgtgccagcaacggtcacgcacctgggagcagcgggcacctg
tcgggcgctgactcggagagccaggaggagaacacgcagctctga

KEGG   Macaca mulatta (rhesus monkey): 718387
Entry
718387            CDS       T01028                                 

Gene name
PLCB1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00562  Inositol phosphate metabolism
mcc01100  Metabolic pathways
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04062  Chemokine signaling pathway
mcc04070  Phosphatidylinositol signaling system
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04310  Wnt signaling pathway
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04613  Neutrophil extracellular trap formation
mcc04621  NOD-like receptor signaling pathway
mcc04713  Circadian entrainment
mcc04720  Long-term potentiation
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04728  Dopaminergic synapse
mcc04730  Long-term depression
mcc04742  Taste transduction
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04919  Thyroid hormone signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04929  GnRH secretion
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04961  Endocrine and other factor-regulated calcium reabsorption
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc04973  Carbohydrate digestion and absorption
mcc05010  Alzheimer disease
mcc05016  Huntington disease
mcc05017  Spinocerebellar ataxia
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05142  Chagas disease
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05163  Human cytomegalovirus infection
mcc05200  Pathways in cancer
Module
mcc_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    718387 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    718387 (PLCB1)
   04310 Wnt signaling pathway
    718387 (PLCB1)
   04371 Apelin signaling pathway
    718387 (PLCB1)
   04020 Calcium signaling pathway
    718387 (PLCB1)
   04070 Phosphatidylinositol signaling system
    718387 (PLCB1)
   04072 Phospholipase D signaling pathway
    718387 (PLCB1)
   04071 Sphingolipid signaling pathway
    718387 (PLCB1)
   04022 cGMP-PKG signaling pathway
    718387 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    718387 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    718387 (PLCB1)
   04613 Neutrophil extracellular trap formation
    718387 (PLCB1)
   04621 NOD-like receptor signaling pathway
    718387 (PLCB1)
   04062 Chemokine signaling pathway
    718387 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    718387 (PLCB1)
   04922 Glucagon signaling pathway
    718387 (PLCB1)
   04929 GnRH secretion
    718387 (PLCB1)
   04912 GnRH signaling pathway
    718387 (PLCB1)
   04915 Estrogen signaling pathway
    718387 (PLCB1)
   04921 Oxytocin signaling pathway
    718387 (PLCB1)
   04926 Relaxin signaling pathway
    718387 (PLCB1)
   04935 Growth hormone synthesis, secretion and action
    718387 (PLCB1)
   04918 Thyroid hormone synthesis
    718387 (PLCB1)
   04919 Thyroid hormone signaling pathway
    718387 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    718387 (PLCB1)
   04916 Melanogenesis
    718387 (PLCB1)
   04924 Renin secretion
    718387 (PLCB1)
   04925 Aldosterone synthesis and secretion
    718387 (PLCB1)
   04927 Cortisol synthesis and secretion
    718387 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    718387 (PLCB1)
   04270 Vascular smooth muscle contraction
    718387 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    718387 (PLCB1)
   04971 Gastric acid secretion
    718387 (PLCB1)
   04972 Pancreatic secretion
    718387 (PLCB1)
   04973 Carbohydrate digestion and absorption
    718387 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    718387 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    718387 (PLCB1)
   04725 Cholinergic synapse
    718387 (PLCB1)
   04728 Dopaminergic synapse
    718387 (PLCB1)
   04726 Serotonergic synapse
    718387 (PLCB1)
   04720 Long-term potentiation
    718387 (PLCB1)
   04730 Long-term depression
    718387 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    718387 (PLCB1)
  09157 Sensory system
   04742 Taste transduction
    718387 (PLCB1)
   04750 Inflammatory mediator regulation of TRP channels
    718387 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    718387 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    718387 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    718387 (PLCB1)
   05016 Huntington disease
    718387 (PLCB1)
   05017 Spinocerebellar ataxia
    718387 (PLCB1)
   05022 Pathways of neurodegeneration - multiple diseases
    718387 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    718387 (PLCB1)
   04934 Cushing syndrome
    718387 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    718387 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    718387 (PLCB1)
   05142 Chagas disease
    718387 (PLCB1)
   05143 African trypanosomiasis
    718387 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    718387 (PLCB1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     718387 (PLCB1)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    718387 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    718387 (PLCB1)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 718387
NCBI-ProteinID: NP_001244796
Ensembl: ENSMMUG00000004313
UniProt: F6ZKL2
LinkDB
Position
10
AA seq 1216 aa
MAGAQPGVHALQLKPVCVSDSLKKGIKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGRHAKAPKDPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNSSFAKKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMELMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTCSDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLMLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSETPSEVRTTPAENGVNHTTSLTPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKSAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSS
EELGGDIPGKEFDTPL
NT seq 3651 nt   +upstreamnt  +downstreamnt
atggccggggctcaacccggagtgcacgccttgcaactcaagcccgtgtgcgtgtccgac
agcctcaagaagggcatcaaattcgtcaagtgggatgatgactcaactattgttactcca
attattttgaggactgaccctcagggatttttcttttactggacagatcaaaacaaggag
acggagctactggatctcagccttgtcaaagatgccagatgtgggagacacgccaaagct
cccaaggaccccaaattacgtgaacttttggatgtggggaacatcgggcgcctggagcag
cgcatgatcacggtggtgtatgggcctgaccttgtgaacatctcccatttgaatctcgtg
gctttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggcccaaaacatgtccagggatgcatttctggaaaaagcctatactaaacttaag
ctgcaagtcactccagaagggcgtattcctctcaaaaacatatatcgcttgttttcagca
gaccggaagcgagttgaaactgctttagaggcttgtagtcttccatcttcaaggaatgat
tcaatacctcaagaagatttcactccagaagtgtacagagttttcctcaacaacctttgc
cctcgacctgaaattgataacatcttttcagaatttggtgccaaaagcaaaccatatctt
accgttgaccagatgatggattttatcaaccttaagcagcgagatcctcggcttaatgaa
atactttatccacctctaaaacaagagcaagtccaagtattgattgagaagtatgaaccc
aacagcagcttcgccaaaaaaggacaaatatcagtggatgggttcatgcgctatctgagt
ggagaagaaaacggagtcgtttcacctgagaaactggatttgaatgaagacatgtctcag
cccctttctcactatttcattaattcctcgcacaacacctacctcacagctggccaactg
gctggaaactcctctgttgagatgtatcgccaagtgcttctgtctggttgtcgctgtgtg
gagctggactgctggaagggacgaactgcagaagaggaacctgtcatcacccatggcttc
accatgacaactgaaatatctttcaaggaagtgatagaagcaattgcggagtgtgcattt
aagacttcaccttttccaattctcctttcatttgagaaccatgtggattccccaaagcag
caagccaagatggcggagtactgccgactgatctttggggatgcccttctcatggagccc
ctggaaaaatatccactggaatctggagttcctcttccaagccctatggagttaatgtat
aaaattttggtgaaaaataagaagaaatcacacaagtcatcagaaggaagtggcaaaaag
aagctctcagaacaagcctccaacacctgcagcgactcctccagcatgttcgagccctca
tccccaggagccggagaagctgatacggaaagtgacgacgatgatgatgatgatgactgt
aaaaaatcttcaatggatgaggggaccgctggaagtgaggctatggccacagaggaaatg
tctaacctggtgaactacattcagccggtcaagtttgagtcatttgaaatttcaaaaaaa
agaaataaaagttttgaaatgtcttccttcgtggaaaccaaaggacttgaacaactcacc
aagtctccggtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaaa
ggaacacgtgtggattcatccaactatatgcctcagctcttctggaatgcgggttgtcag
atggtggcacttaatttccagacaatggacctggctatgcaaataaatatggggatgtat
gaatacaacggaaagagtggctatcgattgaagccagagttcatgaggaggcctgacaag
cattttgatccatttactgaaggcatcgtagatgggatagtggcaaacactttgtctgtt
aagattatatcaggtcagtttctttctgataagaaagtcgggacttacgtggaagtggat
atgtttggtttgcctgtggatacaaggaggaaggcatttaagaccaagacatcccaagga
aatgctgtgaatcctgtctgggaagaagaacctattgtgttcaaaaaggtggttcttcct
actctggcctgtttgagaatagcagtttatgaagaaggaggtaaattcattggccaccgt
atcttgccagtgcaagccattcggccaggctatcactatatatgtctaaggaatgaaagg
aaccagcctctgatgctgcctgctgtctttgtctacatagaagtgaaagactatgtgcca
gacacatatgcagatgtcattgaagctttatcaaacccaatccggtatgtgaacctgatg
gagcagagagctaagcaattggctgctttgacactggaagatgaagaagaagtaaagaaa
gaggctgatcctggagaaacaccatcagagactccaagtgaagtgagaacaactccagca
gaaaacggggtgaatcacactacatccctgacacccaagccaccctcccaggctctccac
agccagccagctccaggttctgtaaaggcacctgccaaaacagaagatcttattcagagt
gtcttaacagaagtggaagcacagaccatcgaagagctaaagcaacagaaatcgtttgtg
aaacttcaaaagaagcactacaaagaaatgaaagacctggttaagagacaccacaagaaa
accactgaccttatcaaagaacacactaccaagtacaatgaaattcagaatgactacttg
agaaggagagcagctttggaaaagtccgccaaaaaggacagtaagaaaaaatcggaaccc
agcagccctgatcatggttcatcaacgattgagcaagacctcgctgccctggatgctgaa
atgacccaaaaattgatagacttgaaggacaaacaacagcagcagctgcttaatcttcgg
caagaacagtattatagtgaaaaataccagaagcgagaacatattaaactgcttattcaa
aagttgacggatgtcgcagaagagtgtcagaacaatcagttaaagaagctcaaagaaatc
tgtgagaaagaaaagaaagaattaaagaagaaaatggataaaaaaaggcaggagaagata
acagaagctaaatctaaagacaaaagtcagatggaagaggagaagacagagatgatccgg
tcatatatccaggaagtggtgcagtacatcaagaggctagaagaggcgcaaagtaaacgg
caagaaaaactcgtagagaaacacaaggaaatacgtcagcagatcctggatgaaaagccc
aagctgcaggtggagctggagcaagaataccaagacaaattcaaaagactgcccctcgag
attttggaattcgtgcaggaagccatgaaaggaaagatcagtgaagacagcaatcacggt
tctgcccctctctccctgtcctcagaccctggaaaagtgaaccacaagactccctccagt
gaggagctgggaggagacatcccaggaaaagaatttgatactcctctgtga

KEGG   Macaca mulatta (rhesus monkey): 718418
Entry
718418            CDS       T01028                                 

Gene name
PLCB4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 isoform X3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00562  Inositol phosphate metabolism
mcc01100  Metabolic pathways
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04062  Chemokine signaling pathway
mcc04070  Phosphatidylinositol signaling system
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04310  Wnt signaling pathway
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04613  Neutrophil extracellular trap formation
mcc04621  NOD-like receptor signaling pathway
mcc04713  Circadian entrainment
mcc04720  Long-term potentiation
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04728  Dopaminergic synapse
mcc04730  Long-term depression
mcc04742  Taste transduction
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04919  Thyroid hormone signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04929  GnRH secretion
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04961  Endocrine and other factor-regulated calcium reabsorption
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc04973  Carbohydrate digestion and absorption
mcc05010  Alzheimer disease
mcc05016  Huntington disease
mcc05017  Spinocerebellar ataxia
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05142  Chagas disease
mcc05143  African trypanosomiasis
mcc05146  Amoebiasis
mcc05163  Human cytomegalovirus infection
mcc05200  Pathways in cancer
Module
mcc_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    718418 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    718418 (PLCB4)
   04310 Wnt signaling pathway
    718418 (PLCB4)
   04371 Apelin signaling pathway
    718418 (PLCB4)
   04020 Calcium signaling pathway
    718418 (PLCB4)
   04070 Phosphatidylinositol signaling system
    718418 (PLCB4)
   04072 Phospholipase D signaling pathway
    718418 (PLCB4)
   04071 Sphingolipid signaling pathway
    718418 (PLCB4)
   04022 cGMP-PKG signaling pathway
    718418 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    718418 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    718418 (PLCB4)
   04613 Neutrophil extracellular trap formation
    718418 (PLCB4)
   04621 NOD-like receptor signaling pathway
    718418 (PLCB4)
   04062 Chemokine signaling pathway
    718418 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    718418 (PLCB4)
   04922 Glucagon signaling pathway
    718418 (PLCB4)
   04929 GnRH secretion
    718418 (PLCB4)
   04912 GnRH signaling pathway
    718418 (PLCB4)
   04915 Estrogen signaling pathway
    718418 (PLCB4)
   04921 Oxytocin signaling pathway
    718418 (PLCB4)
   04926 Relaxin signaling pathway
    718418 (PLCB4)
   04935 Growth hormone synthesis, secretion and action
    718418 (PLCB4)
   04918 Thyroid hormone synthesis
    718418 (PLCB4)
   04919 Thyroid hormone signaling pathway
    718418 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    718418 (PLCB4)
   04916 Melanogenesis
    718418 (PLCB4)
   04924 Renin secretion
    718418 (PLCB4)
   04925 Aldosterone synthesis and secretion
    718418 (PLCB4)
   04927 Cortisol synthesis and secretion
    718418 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    718418 (PLCB4)
   04270 Vascular smooth muscle contraction
    718418 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    718418 (PLCB4)
   04971 Gastric acid secretion
    718418 (PLCB4)
   04972 Pancreatic secretion
    718418 (PLCB4)
   04973 Carbohydrate digestion and absorption
    718418 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    718418 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    718418 (PLCB4)
   04725 Cholinergic synapse
    718418 (PLCB4)
   04728 Dopaminergic synapse
    718418 (PLCB4)
   04726 Serotonergic synapse
    718418 (PLCB4)
   04720 Long-term potentiation
    718418 (PLCB4)
   04730 Long-term depression
    718418 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    718418 (PLCB4)
  09157 Sensory system
   04742 Taste transduction
    718418 (PLCB4)
   04750 Inflammatory mediator regulation of TRP channels
    718418 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    718418 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    718418 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    718418 (PLCB4)
   05016 Huntington disease
    718418 (PLCB4)
   05017 Spinocerebellar ataxia
    718418 (PLCB4)
   05022 Pathways of neurodegeneration - multiple diseases
    718418 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    718418 (PLCB4)
   04934 Cushing syndrome
    718418 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    718418 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    718418 (PLCB4)
   05142 Chagas disease
    718418 (PLCB4)
   05143 African trypanosomiasis
    718418 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    718418 (PLCB4)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     718418 (PLCB4)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    718418 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    718418 (PLCB4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 EF-hand_6
Other DBs
NCBI-GeneID: 718418
NCBI-ProteinID: XP_015004953
Ensembl: ENSMMUG00000001012
UniProt: H9FVW1
LinkDB
Position
10
AA seq 1206 aa
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVL
ECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPTAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALRSM
MEAGESASPANILEDDNEEEIESADQEEEAHPEFKFGNELSADDLGHKEAVANSVKKASD
DLEHENNKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNI
HYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVS
LNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVI
SGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLA
VLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGF
GDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTTKANVTPQ
SSSELRPTTTAALASGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAK
EHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSD
HKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLISAHEQQTQQLKLS
HDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMK
QSKEMDQLKKVQLEHLEFLEKQNEQLLKSCHAVSQSQGEGDAADGEIGSRDGPQTSNSSM
KLQNAN
NT seq 3621 nt   +upstreamnt  +downstreamnt
atggccaaaccttatgaatttaactggcagaaggaagttccttcctttttgcaagaagga
gcagtttttgacagatacgaagaggaatcctttgtgtttgaacccaactgcctcttcaaa
gtggatgagtttggcttctttctgacatggaaaagtgaaggcaaggaaggacaggtgcta
gaatgctccctcatcaacagtattcggtcgggagccataccaaaggatcccaaaatcttg
gctgctcttgaagctgttggaaaatcagaaaatgatctggaaggtcggatagtttgtgtc
tgcagtggcacagatctagtgaacattagttttacctacatggtggctgaaaatccagaa
gtaactaagcaatgggtagaaggcctgagatcaatcatacacaacttcagggccaacaat
gtcagtccaatgacgtgcctcaagaaacactggatgaaattggcatttatgaccaacaca
aatggtaaaattccagttaggagtattactagaacctttgcatcggggaaaacagaaaag
gtgatctttcaagcactcaaggagttaggtcttcccagtggaaagaatgatgaaattgag
cccacggcatttacttatgaaaagttctatgaactgacacaaaagatttgtcctcggaca
gatatagaagatcttttcaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagatcctcgattgaatgaaattttattt
ccattttatgatgccaaaagggcaatgcagatcattgagatgtatgaacctgatgaagat
ttgaagaaaaaaggccttatatcaagtgatgggttttgcagatatctgatgtcagatgaa
aacgccccagtcttcctagatcgtttagaactttaccaagaaatggaccatcctctggct
cactacttcatcagttcttcccataacacttacctgactggcagacagttcggcgggaag
tcttcggtagagatgtacagacaggttctcctggctggttgcagatgtgttgaacttgac
tgctgggatggaaaaggtgaagaccaagaaccaataataactcatggaaaagcaatgtgt
acagatatcctttttaaggatgtaattcaagccatcaaggaaactgcatttgtcacatca
gaatatcctgtaattctctcctttgaaaatcactgcagcaaatatcaacagtacaagatg
tccaaatattgcgaagatctatttggagatctcctgttgaaacaagcgcttgaatcacat
ccacttgaaccaggcagacctttgccatcccccaatgacctcaaaagaaaaatactcata
aaaaacaagaggctgaaacctgaagttgaaaaaaaacagctggaagctttgagaagcatg
atggaagctggagaatctgcctccccagcaaacatcttagaggatgataatgaagaggag
atcgaaagtgctgaccaagaggaggaagctcaccccgaattcaaatttggaaatgaactt
tctgctgatgacttgggtcacaaggaagctgttgcaaatagcgtcaagaaggcctcagat
gaccttgaacatgaaaacaacaaaaagggcctggtaactgtagaagatgagcaggcgtgg
atggcatcttataaatatgtaggtgctaccactaatatccatccatatttgtccacaatg
atcaactacgcccagcctgtaaagtttcaaggtttccatgtggcagaagaacgcaatatt
cattataacatgtcttcttttaatgaatcagtcggtcttggctacttgaagacacatgca
attgaatttgtcaattataacaaacggcaaatgagtcgcatttaccccaagggaggccga
gtcgattccagtaattacatgcctcagattttctggaacgctggctgccagatggtttcc
ctgaactatcaaaccccagatttagcgatgcaattgaatcagggaaaatttgagtataat
ggatcgtgcgggtaccttctcaaaccagatttcatgaggcggcctgatcgaacatttgac
cccttctctgaaactcctgttgatggcgttattgcagccacttgctcagtgcaggttata
tcaggtcaattcttatcagataagaaaattggcacctatgtagaagtggatatgtatggg
ttgcccactgacactatacgtaaggaattccgaactcgtatggttatgaataatggacta
aatccagtttacaatgaagagtctttcgtatttcggaaggtgatcctgccagacctggct
gtcttgagaatagcagtgtatgatgataacaacaagctgattggccagaggatcctcccg
cttgatggcctccaagcaggataccgacacatttcccttcgaaatgagggaaataaacca
ttatcactgccaacaattttctgcaatattgttcttaaaacatacgtgcctgatggattt
ggagatattgtggatgctttatcagatccaaagaaatttctctcaattacagaaaagaga
gcagaccaaatgagagctatgggcattgaaactagtgacatagctgatgtgcccagtgac
acttccaaaaatgacaagaaaggaaaggccaataccaccaaagcaaacgtgacccctcag
agtagctctgagctcagaccaaccaccacagctgccctggcctctggtgtggaagccaaa
aaaggtattgaacttatccctcaagtaaggatagaagatttaaagcagatgaaggcttac
ttgaagcatttaaagaaacagcagaaagagctaaattctttaaagaagaaacatgcaaag
gagcacagtaccatgcagaagttacactgcacgcaagttgacaaaattgtggcacagtat
gacaaagagaagtcgactcatgagaaaatcctagagaaggcaatgaagaagaagggggga
agtaattgtctcgaaatgaaaaaagaaacagaaattaaaattcagacgctgacatcagat
cacaaatctaaggtcaaagagattgtagcacagcacacaaaggaatggtcagaaatgatc
aatacccacagtgctgaggagcaagaaatccgagacctgcacctcagccagcagtgtgag
ctgctgaaaaagctactcatcagtgcccacgagcagcaaacccagcagctgaaactgtcc
catgacagggaaagcaaggaaatgcgagcacaccaggctaagatttctatggaaaatagc
aaagccatcagccaagataaatctatcaagaataaggcagaacgggaaaggcgagtcagg
gagttaaacagcagcaacactaaaaagtttctggaagaaagaaagagactcgcaatgaag
cagtccaaagaaatggatcagttgaaaaaagtccagcttgaacatctagaattcctagag
aaacagaatgagcagcttttgaaatcctgtcatgcagtgtcccaatcgcaaggcgaagga
gatgcagcagatggtgaaattggaagccgagatggaccgcagaccagcaacagtagtatg
aaactccaaaatgcaaactga

DBGET integrated database retrieval system