KEGG   Macaca mulatta (rhesus monkey): 702024
Entry
702024            CDS       T01028                                 

Gene name
IFIH1
Definition
(RefSeq) interferon-induced helicase C domain-containing protein 1
  KO
K12647  interferon-induced helicase C domain-containing protein 1 [EC:3.6.4.13]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc05161  Hepatitis B
mcc05162  Measles
mcc05164  Influenza A
mcc05168  Herpes simplex virus 1 infection
mcc05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    702024 (IFIH1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    702024 (IFIH1)
   05171 Coronavirus disease - COVID-19
    702024 (IFIH1)
   05164 Influenza A
    702024 (IFIH1)
   05162 Measles
    702024 (IFIH1)
   05168 Herpes simplex virus 1 infection
    702024 (IFIH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mcc04054]
    702024 (IFIH1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     702024 (IFIH1)
Pattern recognition receptors [BR:mcc04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   702024 (IFIH1)
SSDB
Motif
Pfam: CARD_2 RIG-I_C RIG-I_C-RD ResIII Helicase_C DEAD CARD SWI2_SNF2 AAA_22 DUF3638 AAA_19
Other DBs
NCBI-GeneID: 702024
NCBI-ProteinID: NP_001040588
Ensembl: ENSMMUG00000003202
UniProt: Q0GBW6
LinkDB
Position
12
AA seq 1025 aa
MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVE
LLLSTLEKGVWHLGWTREFVEALRRAGSPLAARYMNPELTDLPSPSFENAHDECLQLLNL
LQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSA
FLDVLRQTGNDELVQELTGTDCSESNAEIENLSQDDGPQVEEQLLSTTVQPNLEKEVWGM
ENNSSESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEENVAARA
SPEPELQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVI
VLVNKVLLVEQLFRKEFKPFLKKWYRVIGLSGDTQLKISFPEVVKSCDIIISTAQILENS
LLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRRYLMQKLKNNRLKKENKPVIP
LPQMLGLTASPGVGGATKQAKAEEHILKLCANLDAFTIKTVKENLDQLKNQIQEPCKKFA
IADDTREDPFKEKLLEIMTRIQTYCQMSPMSDFGTQPYEQWAIQMEKKAAKEGNRKDRVC
AEHLRKYNEALQINDTIRMIDAYNHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDE
DDLKKPLKLDETDRFLMTLFFENNKMLKKLAENPEYENEKLTKLRNTIMEQYTRTEESAR
GIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNEQKEVISKFRT
GKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSGSGV
IERETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRSIAKHYKNNP
SLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADYQTNGEI
ICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCL
FSDED
NT seq 3078 nt   +upstreamnt  +downstreamnt
atgtcgaatgggtattccacagacgagaatttccgctatctcatctcgtgcttcagggcc
agggtgaaaatgtacatccaggtggagcctgtgctggactacctgacctttctgcctgca
gaggtgaaggagcagattcagaggacggtcgccacctccgggaacatgcaggcagttgaa
ctgctcctgagcaccttggagaagggagtctggcaccttggttggactcgggaattcgtg
gaggccctccgaagagcgggcagccctctggccgcccgctacatgaaccctgagctcact
gacttgccctctccatcgtttgagaacgctcatgatgaatgtctccaactgctgaacctc
cttcagcccactctggtggacaagcttctagttagagacgtcttggataagtgcatggag
gaggaactgttgacaattgaagacagaaaccggattgctgctgcagaaaacaacggaaat
gaatcaggtgtaagagaactactaaaaaggattgtgcagaaagaaaactggttctctgca
tttctggatgttcttcgtcaaacaggaaacgatgaacttgtccaagagttaacaggcact
gattgctcagaaagcaatgcagagattgagaatttatcacaagatgatggtcctcaagtg
gaagagcaacttctttcaaccacagttcagccaaatctggagaaggaggtctggggcatg
gagaataactcatcagaatcatcttttgcagattcttctgtagtttcagaatcagacaca
agtttggcagaaggaagtgtcagctgcttagatgaaagtcttggacataacagcaacatg
ggcagtgattcaggcaccatgggaagtgattcagatgaagagaatgtggcagcaagagca
tccccagagccagaactccagctcaggccttaccaaatggaagttgcccagccagccttg
gaagggaagaatatcatcatctgccttcctacagggagtggaaaaaccagagtggccgtt
tacattgccaaggatcacttagacaagaagaaaaaagcatctgagcctggaaaagttatc
gttcttgtcaataaggtactgttagttgaacagctcttccgcaaggagttcaaaccattt
ttgaagaaatggtatcgtgttattggattaagtggtgatacccaactgaaaatatcattt
ccagaagttgtcaagtcgtgtgatattattatcagtacagctcaaatccttgaaaattcc
ctcttaaacttggaaaatggagaagatgctggtgttcaattgtcagacttttccctcatt
atcattgatgaatgtcatcacaccaacaaagaagcagtgtataataacatcatgaggcgt
tatttgatgcagaagttgaaaaacaatagactcaagaaagaaaacaagccagtgattcct
cttcctcagatgctgggactaacagcttcacctggtgttggaggggccacaaagcaagct
aaagccgaagaacacattttaaaactatgtgccaatcttgatgcatttactattaaaact
gttaaagaaaaccttgatcaactgaaaaaccaaatacaggagccatgcaagaagtttgca
attgcagatgacaccagagaagatccatttaaagagaaacttctagaaataatgacaagg
attcaaacttattgtcaaatgagtccaatgtcagattttggaactcaaccctatgaacaa
tgggccattcaaatggaaaaaaaagctgcaaaagaaggaaatcgcaaagaccgtgtttgt
gcagaacacttgaggaagtacaatgaggccttacaaattaatgacacaattcgaatgata
gatgcatataatcatcttgaaactttctataatgaagagaaagataagaagtttgcagtc
atagaagatgatagtgatgagggtggtgatgatgagtattgtgatggtgatgaagatgag
gatgatttaaagaaacctttgaaactggatgaaacagatagatttctcatgactttattt
tttgaaaacaataaaatgttgaaaaaactggctgaaaacccagaatatgaaaatgaaaag
ctgaccaaattaagaaataccataatggagcaatatactaggactgaggaatcagcacga
ggaataatctttacaaaaacacggcagagtgcatatgcactttcccagtggattactgaa
aatgaaaaatttgctgaagtaggagtcaaagcccaccatctgataggagctggacacagc
agtgagttcaaacccatgacacagaatgaacaaaaagaagtcattagtaaatttcgcact
ggaaaaataaatctgcttatcgctaccacagtggcagaagaaggtctggatattaaagaa
tgtaacattgttatccgttatggtcttgtcaccaatgaaatagccatggtccaggcccgt
ggtcgagccagagctgatgagagcacctatgtcctggttgctcacagcggttcaggagtt
atcgaacgtgagacagttaatgatttccgagagaagatgatgtataaagctatacactgt
gttcaaaatatgaaaccagaggagtatgctcataagattttggaattacagatgcaaagt
ataatggaaaagaaaatgaaaaccaagagaagtattgccaagcattacaagaataaccca
tcactaataactttcctttgcaaaaactgcagcgtgctagcctgttctggggaagatatc
cacgtaattgagaaaatgcatcatgtcaatatgaccccagaattcaaggaactttacatt
gtaagagaaaataaagccctgcaaaagaagtgtgctgactatcaaacaaacggtgaaatc
atctgcaaatgtggccaggcttggggaacaatgatggtgcacaaaggcttagatttgcct
tgtctcaaaataaggaattttgtagtggttttcaaaaataattcaacaaagaaacaatac
aaaaagtgggttgaattacctatcacatttcccaatcttgactattcggaatgctgttta
tttagtgatgaggattaa

DBGET integrated database retrieval system