KEGG   Macaca mulatta (rhesus monkey): 702077
Entry
702077            CDS       T01028                                 

Gene name
FOS
Definition
(RefSeq) proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04024  cAMP signaling pathway
mcc04210  Apoptosis
mcc04380  Osteoclast differentiation
mcc04620  Toll-like receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04668  TNF signaling pathway
mcc04713  Circadian entrainment
mcc04725  Cholinergic synapse
mcc04728  Dopaminergic synapse
mcc04915  Estrogen signaling pathway
mcc04917  Prolactin signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04926  Relaxin signaling pathway
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04932  Non-alcoholic fatty liver disease
mcc04935  Growth hormone synthesis, secretion and action
mcc05031  Amphetamine addiction
mcc05132  Salmonella infection
mcc05133  Pertussis
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05142  Chagas disease
mcc05161  Hepatitis B
mcc05162  Measles
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05224  Breast cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05323  Rheumatoid arthritis
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    702077 (FOS)
   04668 TNF signaling pathway
    702077 (FOS)
   04024 cAMP signaling pathway
    702077 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    702077 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    702077 (FOS)
   04660 T cell receptor signaling pathway
    702077 (FOS)
   04658 Th1 and Th2 cell differentiation
    702077 (FOS)
   04659 Th17 cell differentiation
    702077 (FOS)
   04657 IL-17 signaling pathway
    702077 (FOS)
   04662 B cell receptor signaling pathway
    702077 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    702077 (FOS)
   04917 Prolactin signaling pathway
    702077 (FOS)
   04921 Oxytocin signaling pathway
    702077 (FOS)
   04926 Relaxin signaling pathway
    702077 (FOS)
   04935 Growth hormone synthesis, secretion and action
    702077 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    702077 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    702077 (FOS)
   04728 Dopaminergic synapse
    702077 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    702077 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    702077 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    702077 (FOS)
   05231 Choline metabolism in cancer
    702077 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    702077 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    702077 (FOS)
   05224 Breast cancer
    702077 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    702077 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    702077 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    702077 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    702077 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    702077 (FOS)
   05135 Yersinia infection
    702077 (FOS)
   05133 Pertussis
    702077 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    702077 (FOS)
   05170 Human immunodeficiency virus 1 infection
    702077 (FOS)
   05161 Hepatitis B
    702077 (FOS)
   05171 Coronavirus disease - COVID-19
    702077 (FOS)
   05162 Measles
    702077 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    702077 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    702077 (FOS)
   05142 Chagas disease
    702077 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    702077 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    702077 (FOS)
   04131 Membrane trafficking [BR:mcc04131]
    702077 (FOS)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    702077 (FOS)
Membrane trafficking [BR:mcc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    702077 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin HALZ DUF3450
Other DBs
NCBI-GeneID: 702077
NCBI-ProteinID: NP_001091869
Ensembl: ENSMMUG00000040100
UniProt: A5A6H2 G7MYU7
LinkDB
Position
7
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPTPSAGAYSRAGIVKTMTGSRA
QSTGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEAATPESEEAFT
LPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctcgggcttcaacgcagactacgaggcgtcatcctcgcgctgcagcagcgcg
tccccggccggggatagcctctcctactaccactcacccgccgattccttctccagcatg
ggctcgcctgtcaacgcgcaggacttctgcacggacctggccgtctccagtgccaacttc
attcccacggtcactgccatctcgaccagtccggacctgcagtggcttgtgcagccggcc
ctcgtctcctctgtggccccatcgcagaccagagcccctcaccccttcggagtccccact
ccctccgctggggcttactccagggctggcattgtgaagaccatgacaggaagccgagcg
cagagcactggcaggaggggtaaggtggaacagttatctccagaagaagaagagaaaagg
agaatccgaagggaaaggaataagatggctgcagccaaatgccgcaaccggaggagggag
ctgactgatacactccaagcggagacagaccaactagaagatgagaagtctgctttgcag
accgagattgccaacctgctgaaggagaaggaaaaactagaattcatcctggcagctcac
cgacctgcctgcaagatccctgatgacctgggctttccagaagagatgtctgtggcttcc
cttgatctgactgggggcctgccagaggctgccaccccagagtctgaggaggccttcacc
ctgcctctcctcaatgacccagagcccaagccctcagtggagcctgtcaagagcatcagc
agcatggagctgaaggctgagccctttgatgacttcctgttcccagcatcatccaggccc
agcggctctgagacagcccgctctgtaccagacatggacctatctgggtccttctatgca
gcagactgggagcccctgcacagtggctccctggggatggggcccatggccacagagctg
gagcccctgtgcactccggtggtcacctgtactcccagctgcactgcttacacgtcttcc
ttcgtcttcacctaccccgaggctgactccttccccagctgcgcagctgcccaccgcaaa
ggcagcagcagcaatgagccctcctctgactcgctcagctcacccacgctgctggccctg
tga

DBGET integrated database retrieval system