KEGG   Macaca mulatta (rhesus monkey): 702163
Entry
702163            CDS       T01028                                 

Gene name
CAV3
Definition
(RefSeq) caveolin-3
  KO
K12959  caveolin 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04510  Focal adhesion
mcc05020  Prion disease
mcc05100  Bacterial invasion of epithelial cells
mcc05205  Proteoglycans in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    702163 (CAV3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    702163 (CAV3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    702163 (CAV3)
  09164 Neurodegenerative disease
   05020 Prion disease
    702163 (CAV3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    702163 (CAV3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    702163 (CAV3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    702163 (CAV3)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    702163 (CAV3)
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 702163
NCBI-ProteinID: NP_001181007
Ensembl: ENSMMUG00000009700
LinkDB
Position
2
AA seq 151 aa
MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV
SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI
YSLCIRTFCNPLFAALGQVCSSIKVVLRKEV
NT seq 456 nt   +upstreamnt  +downstreamnt
atgatggcagaagagcacacagacctcgaggcccagatcgtcaaggatatccactgcaag
gagattgacctggtgaaccgagaccccaaaaacattaacgaggacatagtcaaggtggat
ttcgaagatgtgattgcagagcccgtgggcacctacagctttgacggcgtgtggaaggtg
agctacaccaccttcaccgtctccaagtactggtgctaccgcctgttgtccacgctgctg
ggtgtcccgctggccctgctctggggcttcctgttcgcctgcatctccttctgccacatc
tgggcggtggtgccgtgcattaagagctacctgattgagatccagtgcatcagccacatc
tactcactctgcatccgcaccttctgcaacccactcttcgcggccctgggccaggtctgc
agcagcatcaaggtggtgctgcggaaggaggtctaa

KEGG   Macaca mulatta (rhesus monkey): 704449
Entry
704449            CDS       T01028                                 

Gene name
CAV1
Definition
(RefSeq) caveolin-1
  KO
K06278  caveolin 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04510  Focal adhesion
mcc05020  Prion disease
mcc05100  Bacterial invasion of epithelial cells
mcc05205  Proteoglycans in cancer
mcc05416  Viral myocarditis
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    704449 (CAV1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    704449 (CAV1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    704449 (CAV1)
  09164 Neurodegenerative disease
   05020 Prion disease
    704449 (CAV1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    704449 (CAV1)
   05416 Viral myocarditis
    704449 (CAV1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    704449 (CAV1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    704449 (CAV1)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    704449 (CAV1)
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 704449
NCBI-ProteinID: NP_001162085
Ensembl: ENSMMUG00000014122
LinkDB
Position
3
AA seq 178 aa
MSGGKYVDSEGHLYTVPIRKQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLN
DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFA
ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
NT seq 537 nt   +upstreamnt  +downstreamnt
atgtctgggggcaaatacgtagactcggagggacatctctacaccgttcccatccggaaa
cagggcaacatctacaagcccaacaacaaggccatggcagacgagctgagcgagaagcaa
gtgtacgacgcgcacaccaaggagatcgacctggtcaaccgcgaccctaaacacctcaac
gacgacgtggtcaagattgactttgaagatgtgattgcagaaccagaagggacacacagt
ttcgatggcatttggaaggccagcttcaccaccttcactgtgacgaaatactggttttac
cgcttgctgtctgccctctttggcatcccaatggcgctcatctggggcatttacttcgcc
attctctctttcctgcacatctgggcagttgtaccatgcattaagagcttcctgattgag
attcagtgcatcagccgtgtctattccatctacgtccacaccgtctgtgacccactcttt
gaagctgttgggaaaatattcagcaatgtccgcatcaacttgcagaaagaaatatga

KEGG   Macaca mulatta (rhesus monkey): 706980
Entry
706980            CDS       T01028                                 

Gene name
CAV2
Definition
(RefSeq) caveolin-2
  KO
K12958  caveolin 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04510  Focal adhesion
mcc05020  Prion disease
mcc05100  Bacterial invasion of epithelial cells
mcc05205  Proteoglycans in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    706980 (CAV2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    706980 (CAV2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    706980 (CAV2)
  09164 Neurodegenerative disease
   05020 Prion disease
    706980 (CAV2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    706980 (CAV2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    706980 (CAV2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    706980 (CAV2)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    706980 (CAV2)
SSDB
Motif
Pfam: Caveolin SPC12
Other DBs
NCBI-GeneID: 706980
NCBI-ProteinID: NP_001162090
Ensembl: ENSMMUG00000045554
UniProt: H9FN78
LinkDB
Position
3
AA seq 162 aa
MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSAQDRDPHRLNSHLKLGFEDVIAEP
VTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVK
TCLMVLPSVQTIWKSVTDVFVAPLCTSVGRSFSSVSLQLSQD
NT seq 489 nt   +upstreamnt  +downstreamnt
atgggactggagacggagaaggcggacgtgcagctcttcatggacgacgactcctacagc
caccacagcggcctcgagtatgccgaccccgagaagttcgcggactcggcccaggaccgg
gatccccaccggctcaactcacatctcaagctgggcttcgaggatgtgatcgcagagccg
gtgactacgcactcctttgacaaagtgtggatctgcagccatgccctctttgaaatcagc
aaatacgtaatgtacaagttcctgacggtgttcctggccattcccctggccttcattgcg
ggaattctctttgccaccctcagctgtctgcacatctggattttaatgccttttgtaaag
acctgcctaatggttctgccttcagtgcagacaatatggaagagtgtgacagatgttttc
gttgctccattgtgtacaagcgtaggacgaagcttctcttctgtcagcctgcaactgagc
caggactga

DBGET integrated database retrieval system