KEGG   Macaca mulatta (rhesus monkey): 702264Help
Entry
702264            CDS       T01028                                 

Gene name
NEU4
Definition
(RefSeq) neuraminidase 4
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00511  Other glycan degradation
mcc00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    702264 (NEU4)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    702264 (NEU4)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     702264 (NEU4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR Transglut_core3
Motif
Other DBs
NCBI-GeneID: 702264
NCBI-ProteinID: XP_001095081
Ensembl: ENSMMUG00000014405
UniProt: F7BQS5
LinkDB All DBs
Position
12
AA seq 497 aa AA seqDB search
MMSSAAFPRWPQSMGAPHTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPD
DSHAHRLVLRRGTRAGGSVRWGALQVLGTAALAEHRSMNPCPVHDTGTGTVFLFFIAVLG
HTPEAVQIATGRNAARLCYVASRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQL
PSGRLLVPAYTYRVDRRECFGKICRTSPHSFAFYSDDHGRTWRCGGLVPNLRSGECQLAA
VDGGQAGSFLYCNARSTLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSIVGFPAPA
PSRPRDDGWSVGPGSPLHPPRLGPGVREPPEEAAGDPHGAQVPGGPCSHLQPQGDGPRQP
GPRPGVSGDVGSWTLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQAPLDPHSWT
EPWVIYEGPSGYSDLASVGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPTS
PEPPNLGDKPRGCCWPS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgatgagctctgcagccttcccgaggtggccgcagagcatgggggcccctcatacccct
tcacggacagtgctctttgagcgggagaggaccggcctgacctaccgcgtgccctcgctg
ctccctgtgccccccgggcccaccctgctggcctttgtggagcagcggctcagccccgat
gactcccatgcccaccgcctggtgctgaggaggggcacgcgggccgggggctccgtgcgg
tggggcgccctgcaggtgctggggacagcagccttggcagagcaccggtccatgaacccc
tgccccgtgcacgacactggcacaggcaccgtcttcctcttcttcatcgcggtgctgggc
cacacgcccgaggccgtgcagatcgccacgggaaggaacgccgcacgcctctgctacgtg
gccagccgtgacgccggcctctcgtggggcagcgcccgggacctcaccgaggaggccatt
ggtggtgccgtgcaggactgggccacgttcgccgtgggtcccggccacggcgtgcagctg
ccctcaggccgcctgctggtgcccgcctacacctaccgcgtggaccgccgagagtgtttt
ggcaagatctgccggaccagcccccactccttcgccttctacagcgatgaccacggccgc
acctggcgctgtggaggcctcgtgcccaacctgcgctcgggcgagtgccagctggcggca
gtggatggtggacaggccggcagcttcctctactgcaatgcccggagcaccctgggcagc
cgcgtgcaggcactcagcactgacgagggcacctccttcctgcccgcagagcgtgtggct
tccctgcctgagaccgcctggggctgccagggcagcatcgtgggcttcccagcccccgcc
cccagcaggccacgggatgacggttggtcagtgggccccgggagtccccttcaccctcca
cgccttggtcctggagtccgtgaacccccagaggaggctgccggagacccccatggagcc
caggtgcctggtgggccctgcagccatctgcagcctcagggggatggccccaggcagcct
ggccccaggcctggggtcagtggggatgtggggtcctggaccctagcgctccccatgccc
tttgctgccccaccccagagccccacgtggctgctgtactcccacccagtggggcgcagg
gctcggctgcacatgggtatccggctgagccaggccccgctggacccgcacagctggaca
gagccctgggtgatctacgagggccccagcggctactccgacctggcgtccgtcgggccg
gcccctgaggggggcctggtttttgcctgcctgtacgagagtggggccaggacctcctat
gatgagatttccttttgcacattctccctacgtgaggtcctggagaacgtgcccaccagc
cccgagccgcccaaccttggggacaagcctcgggggtgctgctggccctcctga

DBGET integrated database retrieval system