KEGG   Macaca mulatta (rhesus monkey): 702385
Entry
702385            CDS       T01028                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04390  Hippo signaling pathway
mcc04392  Hippo signaling pathway - multiple species
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05219  Bladder cancer
mcc05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    702385 (RASSF1)
   04390 Hippo signaling pathway
    702385 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    702385 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    702385 (RASSF1)
   05206 MicroRNAs in cancer
    702385 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    702385 (RASSF1)
   05223 Non-small cell lung cancer
    702385 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH DUF2252
Other DBs
NCBI-GeneID: 702385
NCBI-ProteinID: XP_014986340
Ensembl: ENSMMUG00000006996
LinkDB
Position
2
AA seq 345 aa
MRSFLGAKCACPRPGVPPPMTQELDPGDLRFSLNGCGAALARAHAHTDTRTRTHATGAVV
GGYGRAGPGGRAGAAMGEAETPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSLARRP
RRDQDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVS
VPSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHLHVLSRTKAREVIEALLRKFLV
VDDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDA
FSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgaggtcattcctcggggctaagtgtgcgtgtccccgccccggcgttcctcccccaatg
acacaagagctagatcccggcgatctacgtttcagtcttaacggttgcggcgcggcgctg
gcccgggcgcacgcgcacactgacacgcgtacacgcacgcacgcgaccggggcggtggtt
ggcggctacggacgcgcgggaccagggggacgggcgggtgcggcgatgggcgaggcggag
acgccttctttcgagatgacctggagcagcacgacgagcagtggctactgcagccaagag
gactcggactcggagctcgagcagtacttcaccgcgcgaacctcgctagcgcgcaggccg
cgccgggaccaggacgagcccgtggagtgggagacacctgacctttctcaagctgagatt
gagcagaagatcaaggagtacaatgcccagatcaatagcaacctcttcatgagcttgaac
aaggatggttcttacacaggcttcatcaaggttcagctgaagctggtgcgccctgtctct
gtgccctccagcaagaagccaccctccttgcaggatgcccggcggggcccaggacggggc
acaagtgtcaggcgccgcacttccttttacctgcccaaggatgctgtcaagcacctgcat
gtgctgtcacgcacaaaggcacgtgaagtcattgaggccctgctgcgaaagttcttggtg
gtggatgacccccgcaagtttgcactctttgagcgggctgagcgtcatggccaagtgtac
ttgcggaagctgttggatgatgagcagcccctgcggctgcggctcctggcagggcccagt
gacaaggccctgagcttcgtcctgaaggaaaatgactctggggaggtgaactgggatgcc
ttcagcatgcctgaattacataacttcctgcgtatcctgcagcgggaggaggaggagcac
ctccgccagatcctgcagaagtactcctattgccgccagaagatccaagaggccctgcac
gcctgccccctcgggtga

DBGET integrated database retrieval system