KEGG   Macaca mulatta (rhesus monkey): 702710
Entry
702710            CDS       T01028                                 

Gene name
SP1
Definition
(RefSeq) transcription factor Sp1
  KO
K04684  transcription factor Sp1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04137  Mitophagy - animal
mcc04350  TGF-beta signaling pathway
mcc04915  Estrogen signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc05016  Huntington disease
mcc05017  Spinocerebellar ataxia
mcc05163  Human cytomegalovirus infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05224  Breast cancer
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    702710 (SP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    702710 (SP1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    702710 (SP1)
   04928 Parathyroid hormone synthesis, secretion and action
    702710 (SP1)
   04927 Cortisol synthesis and secretion
    702710 (SP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    702710 (SP1)
   05202 Transcriptional misregulation in cancer
    702710 (SP1)
   05231 Choline metabolism in cancer
    702710 (SP1)
  09162 Cancer: specific types
   05224 Breast cancer
    702710 (SP1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    702710 (SP1)
   05017 Spinocerebellar ataxia
    702710 (SP1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    702710 (SP1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    702710 (SP1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    702710 (SP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    702710 (SP1)
   03029 Mitochondrial biogenesis [BR:mcc03029]
    702710 (SP1)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    702710 (SP1)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    702710 (SP1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_8 zf-C2H2_6
Other DBs
NCBI-GeneID: 702710
NCBI-ProteinID: NP_001253853
Ensembl: ENSMMUG00000020036
UniProt: H9ZCQ3
LinkDB
Position
11
AA seq 786 aa
MSDQDHSMDEMTAVVKIEKGVGGNNGGSGNGGGAFSQARSSSTGSSSSSGGGGGQESQPS
PLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPT
SKEQSGSSTNGSNGSESSKNRTVSGGQYVVAATPNLQNQQVLTGLPGVMPNIQYQVIPQF
QTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQ
GLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPV
TSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRV
SGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAP
LSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQA
QTITLAPMQGVSLGQTSSSSTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGT
SGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRT
RREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCT
WSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVAL
SVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSIN
ISGNGF
NT seq 2361 nt   +upstreamnt  +downstreamnt
atgagcgaccaagatcactccatggatgaaatgacagctgtggtgaagattgaaaaagga
gttggtggcaataatgggggcagtggtaatggtggtggtgccttttcacaggctcgaagt
agcagcacaggcagtagcagcagcagtggaggaggaggagggcaggagtcccagccatcc
cctttggctctgctggcagcaacttgcagcagaattgagtcacccaatgagaacagcaac
aactcccagggcccgagtcagtcagggggaacaggtgagcttgacctcacagccacacaa
ctttcacagggtgccaatggctggcagatcatctcttcctcctctggggctacccctacc
tcaaaggaacagagtggcagcagtaccaatggcagcaatggcagtgagtcttccaagaat
cgcacagtctctggtgggcagtatgttgtggctgccactcccaacttacagaaccagcaa
gttctgacaggactacctggagtgatgcctaatattcagtatcaagtaatcccacagttc
cagaccgttgatgggcaacagctgcagtttgctgccactggggcccaagtgcagcaggat
ggttctggtcaaatacagatcataccaggtgcaaaccaacagattatcacaaatcgagga
agtggaggcaacatcattgctgctatgccaaatctactccagcaggctgtccccctccaa
ggcctggctaataatgtactctcaggacagactcagtatgtgaccaatgtaccagtggcc
ctgaatgggaacatcaccttgctacctgtcaacagcgtttctgcagctaccttgactccc
agctctcaggcagtcaccatcagcagctctgggtcccaggagagcggctcacagcctgtc
acctcagggactaccatcagttctgccagcttggtgtcatcacaagccagttccagctcc
ttttttaccaatgccaatagctactcaactactactaccaccagcaacatgggaattatg
aactttactaccagtggatcatcagggaccaactctcaaggccagacaccccagagggtc
agtgggctacaggggtctgatgctctgaacatccagcaaaaccagacatctggaggctca
ctgcaagcaggtcagcaaaaagaaggagagcaaaaccagcagacacagcagcaacaaatt
cttatccagcctcagctagttcaagggggacaggccctccaggccctccaagcagcacca
ttgtcagggcagacctttacaactcaagctatctcccaagaaaccctccagaacctccag
cttcaggctgttccaaactctggtcccatcatcatccggacaccaacagtggggcccaac
ggacaggtcagttggcagactctacagctgcagaacctccaagttcagaacccacaagcc
cagacaatcaccttagccccaatgcagggtgtttctttgggacagaccagcagcagcagc
accactcttacacccattgcctcagctgcttccattcctgctggcacagtcactgtgaat
gctgctcaactctcctccatgccaggcctccagaccattaacctcagtgcattgggtact
tcaggaatccaggtgcacccaattcaaggcctgccgttggctatagcaaatgctccaggt
gatcatggagctcagcttggtctccatggggctggtggtgatggaatacatgatgacaca
gcaggtggagaggaaggagaaaacagcccagatgcccaaccccaagccggtcggaggacc
cggcgggaagcatgcacctgcccctactgtaaagacagtgaaggaaggggctcgggggat
cctggcaaaaagaaacaacatatttgccacatccaaggctgtgggaaagtgtatggcaag
acttcacacctgcgggcacacttgcgctggcatacaggcgagaggccatttatgtgtacc
tggtcatactgtgggaaacgcttcacacgttcagatgagctacagaggcacaaacgtaca
cacacaggtgagaagaaatttgcctgccctgagtgtcctaagcgcttcatgaggagtgac
cacctgtcaaaacatatcaagacccaccagaataagaagggaggcccaggtgtagctctg
agtgtgggcactttgcccctggacagtggggcaggttcagaaggcagcggcactgccact
ccttcagcccttattaccaccaatatggtagccatggaggccatctgtccagagggcatt
gcccgtcttgccaacagtggcatcaacgtcatgcaggtggcggatctgcagtccattaat
atcagtggcaatggcttctga

DBGET integrated database retrieval system